Details for Capsella Locus Carubv10014425m

Position : scaf_3 ( 5`- 1344853 .. 1346885 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014425m

Protein [Map View]
MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPSIFTHKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNA
YRKIRLRAEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQ
VRQIRRKMRDIMVKEASSCDLKELVAKFIPEAIGKEIEKATQNIYPLQNVFIRKVKILKAPKFDLGKLMDVHGDYTAEDV
GVKVDRPAEETVEEPTEIIGA*

DNA
ATGGCCGTCGGGAAAAACAAGAGAATCTCTAAGGGTAGGAAGGGAGGAAAGAAGAAGGCTGTTGATCCCTTCTCCAAGAA
GGATTGGTATGATGTTAAGGCTCCTTCAATCTTCACCCACAAGAATGTTGGAAAGACGCTTGTTTCCAGAACCCAGGGTA
CCAAGATTGCCTCTGAAGGCTTGAAGCACAGAGTTTTTGAGGTTTCTCTAGCTGATCTTCAAGGTGATGAAGACAATGCT
TACAGGAAGATCCGTCTCAGAGCTGAAGATGTCCAAGGCAGGAACGTTTTGTGCCAATTCTGGGGCATGGACTTCACCAC
TGACAAACTTAGGTCGTTAGTTAAGAAGTGGCAGACTTTGATTGAGGCTCATGTTGATGTTAAAACCACCGATAGCTACA
CTCTCAGGCTATTCTGCATTGCCTTTACCAAGAGACGTGCTAACCAGGTCAAGAGGACTTGCTACGCTCAGTCCAGCCAA
GTTCGTCAGATTCGTAGGAAAATGAGGGATATTATGGTTAAGGAAGCTTCCTCATGTGACCTTAAGGAGCTTGTTGCCAA
GTTCATTCCCGAAGCTATTGGGAAGGAGATTGAGAAGGCAACTCAGAACATCTACCCTCTTCAGAACGTTTTCATCCGTA
AAGTCAAGATCCTGAAGGCACCCAAATTCGACCTTGGCAAGCTCATGGATGTTCACGGAGATTACACAGCAGAAGATGTT
GGTGTTAAGGTAGACAGGCCAGCCGAGGAGACCGTTGAGGAACCTACTGAAATCATCGGAGCATAA