Details for Capsella Locus Carubv10014421m

Position : scaf_3 ( 5`- 3546065 .. 3549037 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014421m

Protein [Map View]
METTPETQPKPHQQSGSHRLPAGREDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNSSHRNGRPKTDVQCK
NRIDTLKKKYKTEKAKPLSSWCFFDRLDFLIGPAVKKPSGGVVKSALMNPNLNPTGSKSTGSSLDDDDDDDEEDDDDDDA
GDWGFVVRKHRRVEDVDPSEGSAFRELARSILKLGEAFERIEGKKQQMMIELEKQRMEVAKDLELQRMNMLMEMQLELEK
SKHGKRRACSALWNLQDKTLVT*

DNA
ATGGAGACGACCCCGGAGACTCAGCCGAAGCCTCACCAACAGAGCGGGTCTCACCGTTTACCGGCGGGGAGAGAGGATTG
GTGGAGCGAGGACGCTACGGCGACGTTGATCGAAGCTTGGGGAGATCGTTACGTCAATCTCAACCGTGGGAATCTCCGGC
AAAACGATTGGAAAGAAGTCGCCGACGCCGTCAATTCGAGCCACAGGAATGGCCGGCCGAAGACCGACGTGCAGTGCAAA
AATCGGATCGATACGTTGAAGAAGAAGTATAAGACTGAAAAGGCGAAGCCTTTGTCGTCGTGGTGCTTCTTTGATAGACT
CGATTTCTTAATTGGTCCGGCTGTGAAGAAACCGTCCGGCGGGGTTGTTAAATCGGCGTTGATGAACCCTAATTTGAATC
CTACTGGATCTAAATCGACGGGTAGCTCTCTTGACGACGACGACGATGATGATGAAGAAGATGATGATGATGATGATGCG
GGTGATTGGGGGTTTGTGGTGAGGAAGCATCGTAGAGTTGAAGACGTAGATCCGAGTGAAGGATCTGCCTTTAGGGAGCT
GGCGAGATCGATTCTGAAGTTAGGGGAAGCGTTTGAAAGAATCGAGGGTAAGAAGCAGCAGATGATGATTGAATTGGAGA
AGCAGAGAATGGAAGTTGCAAAGGACCTTGAGTTGCAACGAATGAACATGTTGATGGAGATGCAATTGGAGCTTGAGAAA
TCCAAACATGGCAAACGAAGAGCTTGTTCAGCACTCTGGAATCTCCAGGACAAGACTCTTGTGACCTGA