Details for Capsella Locus Carubv10014420m

Position : scaf_3 ( 5`- 6790861 .. 6792616 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014420m

Protein [Map View]
MVESELSYEQIRLKRVEENKKRMGELNLNKLAQSLRVSSSPKPSPSKTRTMRMPVDFSEVRRSSRAKGPPPSYKEFGLEP
LERPRRSYQRRDLLNRVYASDEARVYAVDRAEKLQSSLDPEFPSFVKPMLQSHVTGGFWLGLPLRFCKTHLPKRDEWMTL
VDEEDEEFVAKYLVEKNGLSGGWRGFSIDHQLVDGDAVVFHLITPTTFKVYIIRVNDDGNNDSDVNEEDEEDDIDINKKE
KEHVSEARQLRSSGKRKRGGRK*

DNA
ATGGTGGAATCGGAGTTAAGCTATGAGCAGATTCGTTTGAAAAGGGTGGAAGAGAACAAGAAGAGGATGGGGGAGCTTAA
TCTCAACAAGCTCGCTCAATCTCTTCGCGTCTCTTCTTCTCCTAAGCCCTCTCCTTCAAAGACAAGGACGATGCGTATGC
CAGTGGATTTCTCGGAGGTCAGGAGATCAAGCCGTGCCAAGGGTCCACCTCCAAGTTACAAAGAGTTTGGACTAGAACCA
CTGGAGAGGCCAAGAAGGAGCTATCAAAGAAGAGATCTGCTGAACAGGGTATATGCTTCGGACGAGGCACGAGTGTATGC
AGTCGACAGGGCTGAGAAGCTCCAGTCAAGCTTAGATCCAGAATTCCCAAGCTTTGTCAAACCAATGCTTCAATCACACG
TGACTGGAGGTTTTTGGTTGGGCTTGCCGCTTCGTTTTTGCAAGACACATCTACCAAAACGTGATGAATGGATGACTTTG
GTTGACGAGGAAGATGAGGAATTTGTGGCGAAATACCTCGTTGAGAAGAACGGTCTTAGCGGAGGCTGGAGAGGTTTCTC
CATTGATCATCAGTTAGTCGATGGTGATGCTGTCGTGTTTCACCTTATCACCCCAACAACGTTCAAGGTGTATATCATCA
GGGTAAATGATGATGGAAACAATGATTCGGATGTGAATGAAGAAGATGAAGAGGATGATATTGATATAAACAAGAAAGAA
AAGGAGCATGTTTCAGAAGCTAGACAGTTGAGAAGCAGTGGTAAAAGGAAAAGAGGAGGAAGAAAGTAG