Details for Capsella Locus Carubv10014419m

Position : scaf_3 ( 5`- 3974932 .. 3977152 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014419m

Protein [Map View]
MENDGRSSEKNLYEVLGVESTASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVISILGDEEKRAVYDQTGSVDD
ADLSGDVVDNLRDFFRAMYKKVTEEDIEEFEANYRGSESEKNDLIELYKKFKGKMSRLFCSMLCSNPKLDSHRFKDIIDE
AIAVGEVKSTKAYKKWAKEISEIEPPTNPQKMRRKVAKGADKDLYAMISQRRDERKEKFDTLFSSLVSRYGSSADSEPNE
EEFEAAQRKVESRRSSKKSRKK*

DNA
ATGGAGAATGATGGTAGATCCAGTGAGAAAAATCTATACGAGGTTCTTGGTGTGGAATCAACAGCATCTCCACAGGAGAT
AAGGAAGGCATACCATAAGCTAGCATTGAGGCTTCATCCTGATAAAAACAAGGATGATGAGGATGCTAAAGAGAAATTTC
AGCAGCTGCAAAAGGTAATATCAATCCTCGGTGATGAAGAGAAAAGGGCAGTCTATGATCAAACTGGCTCGGTTGATGAT
GCTGATCTATCAGGAGACGTGGTTGACAACTTGAGAGACTTCTTCAGGGCTATGTACAAGAAGGTCACTGAGGAAGATAT
TGAAGAGTTTGAGGCAAACTACAGGGGATCTGAATCCGAAAAAAATGATTTGATTGAGCTCTATAAGAAGTTCAAGGGTA
AAATGAGCAGGCTTTTCTGCTCAATGCTTTGCTCAAACCCCAAGCTTGATTCACACCGTTTCAAGGACATTATTGATGAG
GCCATTGCAGTGGGAGAAGTGAAATCAACAAAAGCTTACAAGAAATGGGCAAAGGAAATTTCTGAAATAGAACCTCCCAC
TAATCCTCAGAAAATGAGACGGAAAGTAGCAAAGGGTGCAGATAAAGATTTATACGCAATGATATCCCAGCGAAGAGATG
AGAGGAAAGAGAAGTTCGATACATTGTTCTCGTCACTTGTCTCTAGGTATGGTAGCAGTGCCGACTCTGAGCCAAACGAA
GAAGAGTTCGAAGCTGCACAGAGAAAAGTTGAAAGCAGGAGATCATCAAAAAAGTCAAGGAAAAAGTAA