Details for Capsella Locus Carubv10014416m

Position : scaf_3 ( 5`- 8216769 .. 8218652 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014416m

Protein [Map View]
MLKKRSRSKQALMADTNQKQSKPTPFPRLFTAFSSFKSFTENDAVASPTSILDTKPFSVLKNPFGSDNPKTQEPETRLKP
EPRRIGLAIVDSLIQDENLEPGSGTILFGSQLRIRVPDSPRSSSDFGIKTRNSQPETTTTKIPTPGSGLGSPRIISGYFS
ASDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPGVVFFRSSDPVNESDSDSFPPDSFLSSCCNCKKSLGPRDDIFMYR
GDRAFCSSECRELEMMTEENDIK*

DNA
ATGCTAAAGAAGAGATCAAGAAGCAAGCAAGCTTTAATGGCGGATACGAACCAGAAACAGAGCAAACCGACGCCGTTTCC
AAGGCTCTTCACAGCTTTCAGTAGCTTCAAAAGCTTCACTGAGAACGACGCCGTCGCTAGCCCGACTTCGATCCTCGACA
CCAAACCTTTCTCCGTTTTGAAAAACCCATTCGGATCCGATAACCCGAAAACCCAAGAACCCGAAACCCGTCTCAAACCC
GAGCCCAGAAGAATCGGACTCGCCATCGTCGACTCTCTCATCCAAGACGAAAACCTTGAACCCGGATCCGGTACAATCCT
ATTCGGGTCACAACTTCGGATCCGGGTCCCGGATTCTCCACGCTCATCGTCCGATTTCGGGATCAAAACGAGGAACTCTC
AGCCGGAGACGACGACGACGAAGATACCAACTCCCGGGTCGGGTCTCGGGTCACCCCGGATAATCTCCGGCTACTTCTCG
GCCAGCGATATGGAGCTATCGGAGGATTACACATGCGTGACGTGTCACGGGCCAAACCCCAGAACAATTCATATATTCGA
TAACTGTATCGTGGAGAGCCAACCGGGCGTGGTGTTCTTCCGAAGCTCCGACCCGGTAAACGAATCGGATTCGGATAGTT
TCCCACCCGACAGCTTTCTCAGTAGTTGCTGTAACTGTAAGAAGAGTCTTGGACCTCGTGATGACATTTTCATGTACAGG
GGAGATAGAGCTTTCTGTAGCAGTGAGTGCAGGGAATTGGAGATGATGACAGAAGAAAATGATATTAAATGA