Details for Capsella Locus Carubv10014415m

Position : scaf_3 ( 5`- 4513545 .. 4516026 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014415m

Protein [Map View]
MRGRSYTPSPPRGYGRRGRSPSPRGRYGGSRDRDLPTSLLVRNLRHDCRQEDLRRPFEEFGPVKDIYLPRDYYTGDPRGF
GFIQYVEPADAAEAKHHMDGFLLLGRELTVVFAEENRKKPTEMRTRDRGGRSNRFQDRRRSPPRYSRSPPPRRGRRSRSR
SRGYNSPPPKRHQSRSVSPQDRRYEKERSYSRSPPHNGSRVRSGSPGRVKSHSRSPRRSLSPRRNRSYTPEQARSQSPVP
RQQSRSPTPVPRAARNGDRSPSQ*

DNA
ATGAGGGGAAGAAGCTACACACCGTCACCACCAAGGGGTTATGGAAGGAGGGGCCGTAGTCCTAGCCCTCGGGGTAGATA
TGGTGGGAGTCGTGACAGGGATCTCCCCACCAGTCTTTTGGTTCGCAACCTACGTCATGATTGCAGGCAAGAAGACCTAA
GGAGGCCATTTGAGGAGTTTGGTCCTGTCAAGGACATCTACCTGCCAAGGGATTACTATACTGGAGATCCAAGGGGGTTT
GGGTTCATTCAGTATGTGGAACCTGCTGATGCTGCTGAGGCAAAACATCACATGGATGGTTTCCTTCTTCTTGGTCGTGA
GTTGACTGTCGTATTTGCAGAAGAGAACCGGAAGAAGCCAACTGAAATGAGAACAAGGGATCGAGGTGGAAGGAGCAACA
GGTTTCAAGACAGAAGGCGTTCTCCTCCTCGGTACTCTCGTTCTCCTCCACCTCGTCGTGGTCGTAGATCACGATCACGT
AGCCGTGGCTATAATTCTCCTCCCCCTAAAAGACATCAATCTAGGTCTGTCTCACCTCAGGATAGACGATACGAGAAGGA
GAGGTCATACTCTCGCTCACCGCCCCATAATGGCTCAAGGGTTCGCAGTGGAAGTCCTGGGAGAGTGAAGAGCCACAGCA
GAAGCCCTAGAAGAAGCCTGAGCCCGAGAAGAAACAGGAGCTACACACCTGAACAAGCCAGGAGCCAAAGCCCGGTCCCT
AGGCAGCAGAGCAGGAGCCCGACCCCAGTCCCTCGTGCGGCAAGAAATGGAGACCGTTCTCCTAGCCAGTGA