Details for Capsella Locus Carubv10014414m

Position : scaf_3 ( 5`- 7081235 .. 7083623 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014414m

Protein [Map View]
MIHFHPHMSLLFADPERPKNDKATILTDTVQLLKELTSEVNKLKSEYTALTDESRELTQEKNDLREEKTALKSDIENLNL
QYQQRLRSMSPWGAAMDHTVMMAPPPSFPYPMPMAMPPGSIPMHPSMPSYTYFGNQNPSMIPAPCPTYMPYMPPNTVVEQ
QSVHIPQNPGNRSREPRAKVSRESRSEKAEDSNEVATQLELKTPGSTSDKDTLQRPEKTKRCKRNNNNSIEESSHSSKCS
SSPSIRDHSSSSSVAGGQKPDDSK*

DNA
ATGATTCACTTCCATCCTCACATGTCTCTTCTGTTTGCAGATCCAGAGAGACCCAAGAACGACAAAGCAACAATTCTGAC
TGATACTGTTCAGTTGCTGAAAGAGCTCACGTCTGAAGTCAACAAACTGAAATCTGAGTACACAGCATTGACAGATGAGT
CACGCGAGTTGACACAGGAGAAAAACGACCTGAGAGAAGAAAAGACAGCGCTGAAATCAGATATAGAGAATCTCAATCTC
CAATACCAGCAGAGGTTAAGGTCAATGTCTCCATGGGGAGCTGCAATGGATCACACAGTCATGATGGCTCCACCTCCGTC
TTTTCCATACCCAATGCCTATGGCTATGCCTCCTGGGTCAATCCCAATGCATCCATCAATGCCATCTTACACGTACTTTG
GGAACCAAAACCCTAGCATGATCCCAGCTCCATGTCCTACATACATGCCGTATATGCCTCCTAATACAGTTGTTGAACAA
CAATCAGTGCACATTCCACAGAACCCAGGTAACCGTTCTCGGGAACCTAGAGCAAAGGTCTCAAGAGAGAGCAGATCAGA
GAAAGCAGAGGACTCTAACGAAGTTGCAACACAGCTCGAGTTAAAAACCCCTGGGTCTACTTCTGATAAGGACACATTGC
AAAGACCAGAGAAGACGAAGAGATGTAAGAGGAACAACAACAACTCCATAGAAGAAAGTTCTCATTCTAGCAAATGCTCA
TCTTCCCCAAGCATCCGAGACCACAGTTCTTCCAGTAGCGTAGCTGGTGGCCAAAAACCTGACGATTCAAAATGA