Details for Capsella Locus Carubv10014412m

Position : scaf_3 ( 5`- 4438365 .. 4440665 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014412m

Protein [Map View]
MICVSLRNRIRNWLRDYVRLQSVVVILIYAQIGCALIGSLGALYNGVLLINLAIALFGLVAIESNSQSLVRTYAFLLFCG
ILLDVSWFILFFKEIWNLSSEMYQAFYIFSVKLTMAMEVAGFVVRLSSSLLWFQIYRLGASIIDTSFPRQSDSDLRNSFL
EPPLLARQRSRDPELRNSFLEPHVIAKPRSRSDEILGDSVDEPASYTPLSDGGQSNITTPNVTQVVKYHSAGDIYKGTPS
SAAEASRNKSPLSRSLEALDSSLR*

DNA
ATGATTTGTGTTTCGTTACGAAATCGAATACGTAATTGGCTTCGCGACTATGTTAGGCTCCAATCCGTCGTTGTGATTCT
TATCTACGCTCAGATTGGGTGCGCGCTGATCGGTTCATTAGGGGCATTGTACAATGGAGTCTTGCTGATAAATTTGGCGA
TTGCGTTATTTGGGTTAGTGGCAATCGAGAGTAATAGCCAGAGTCTTGTCAGAACCTATGCGTTTCTTCTTTTCTGCGGC
ATTCTTCTTGATGTCTCATGGTTCATACTCTTCTTCAAGGAGATTTGGAATCTTTCTTCTGAGATGTATCAAGCCTTCTA
CATCTTCTCTGTGAAACTCACCATGGCTATGGAAGTTGCTGGGTTTGTTGTGAGGTTATCGTCCTCTCTGTTATGGTTTC
AGATTTATAGACTGGGAGCTTCTATCATAGACACTTCATTTCCTCGTCAATCAGATTCAGATTTACGAAATAGCTTCTTA
GAACCTCCTCTTTTAGCTAGGCAACGTTCACGTGATCCAGAATTACGAAATAGCTTCTTAGAGCCTCATGTTATAGCTAA
GCCACGTTCACGTTCTGATGAAATCTTGGGAGATTCTGTTGACGAACCAGCCTCCTACACTCCACTGTCTGATGGCGGCC
AAAGCAATATCACTACGCCCAATGTAACACAGGTGGTTAAATATCATTCAGCTGGAGACATTTACAAAGGAACCCCATCA
TCTGCTGCAGAAGCCTCTCGAAATAAGTCTCCTCTGTCCAGATCCTTGGAGGCACTTGATTCCAGTCTCCGCTGA