Details for Capsella Locus Carubv10014411m

Position : scaf_3 ( 5`- 3621281 .. 3622449 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014411m

Protein [Map View]
METLHPLSHLPISDHRFVFQEMMSLQSSSSSSSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVLDVMNQYSKLE
EDVSDIEAGRVPIPGYPAASSPSAFDPETCRKRPNGARGSDHDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVS
KTPTQVASHAQKYYQRQLSGAKDKRRPSIHDITTVNLLKANLNRSFSDHSDILPDLGFTDKDNAEEGVMFMGQNLSSETL
FSPSPTSFDAAFNFAGANAFSARA*

DNA
ATGGAGACTCTGCATCCACTCTCTCACCTGCCTATCTCTGACCACCGGTTCGTATTTCAAGAGATGATGAGCTTACAAAG
CTCGAGCAGCAGCAGCAGCTGGACTAAAGAAGAGAACAAGATGTTCGAACGAGCTCTTGCCATATACGCTGAAGACTCGC
CTGATCGCTGGTTCAAAGTTGCTTCCATGATCCCTGGGAAGACTGTTTTGGATGTCATGAATCAGTATAGTAAGCTCGAA
GAAGACGTTTCCGATATTGAAGCAGGACGTGTCCCCATTCCTGGTTACCCTGCAGCTTCTTCTCCCTCTGCGTTTGACCC
TGAGACGTGTCGGAAACGGCCTAATGGAGCCAGAGGATCTGATCATGATCGAAAGAAAGGAGTTCCTTGGACTGAGGAAG
AACACAGGAGATTCTTGTTAGGGCTTCTTAAGTACGGGAAAGGAGACTGGAGAAACATATCAAGAAACTTCGTGGTGTCT
AAGACGCCAACACAAGTCGCGAGCCACGCCCAAAAGTATTACCAAAGACAGCTCTCCGGAGCCAAGGACAAACGCCGGCC
AAGTATCCATGACATCACAACCGTCAATCTCCTCAAAGCCAACCTCAACCGTTCCTTTTCCGATCATAGTGACATCCTCC
CAGATTTAGGTTTTACCGACAAGGATAATGCTGAAGAGGGAGTAATGTTTATGGGTCAGAATCTATCTTCAGAAACCTTA
TTTTCTCCATCACCAACATCTTTCGACGCTGCCTTTAACTTCGCCGGAGCAAATGCCTTCAGTGCCAGAGCTTAA