Details for Capsella Locus Carubv10014399m

Position : scaf_3 ( 5`- 3761970 .. 3764702 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014399m

Protein [Map View]
MASVASSTTLISSPSSRVFPVKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSSSRRSLAVKAQAADLPPLVGNTA
PDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYSEFEKLNTEVLGVSVDSVFSHLAWVQTDR
KSGGLGDLNYPLVSDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDE
VCPAGWKPGEKSMKPDPKLSKEYFSAI*

DNA
ATGGCGTCTGTAGCTTCTTCAACCACTCTCATCTCTTCTCCCTCTTCTAGGGTGTTTCCAGTAAAGTCTTCACTTTCCTC
TCCATCTGTATCTTTCCTTCGAACCCTTTCTTCTCCTTCCGCATCTGCTTCTCTCCGGTCCGGGTTTGCTCGGCGCTCTT
CCCTCAGTTCCAGTTCTCGCCGGAGCTTGGCTGTCAAGGCCCAGGCCGCCGATCTTCCACCACTGGTTGGAAACACGGCT
CCTGATTTCGAGGCAGAGGCTGTCTTCGATCAAGAGTTCATCAAGGTTAAGCTCTCTGAGTACATTGGGAAGAAGTATGT
GATTCTCTTTTTCTACCCTTTGGACTTCACTTTCGTCTGCCCAACAGAGATTACTGCCTTCAGTGACCGGTACTCAGAAT
TTGAGAAGTTGAACACAGAAGTATTAGGTGTCTCTGTCGATAGTGTGTTCTCGCATCTTGCCTGGGTCCAAACAGACAGG
AAATCTGGAGGTCTTGGTGATCTGAACTATCCTCTTGTTTCAGATGTCACTAAATCGATCTCGAAATCTTTTGGAGTGCT
CATCCATGATCAGGGAATAGCACTGAGAGGCCTCTTCATAATCGACAAGGAAGGAGTGATCCAACATTCAACCATCAACA
ATCTTGGTATTGGCCGAAGTGTTGATGAGACTATGAGAACCCTCCAGGCGTTACAGTACATCCAGGAAAACCCGGATGAG
GTCTGCCCAGCGGGATGGAAGCCGGGTGAGAAGTCAATGAAACCCGACCCGAAACTCAGCAAAGAGTACTTCTCTGCTAT
CTAG