Details for Capsella Locus Carubv10014398m

Position : scaf_3 ( 5`- 2271492 .. 2275409 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014398m

Protein [Map View]
MAEEAHKVTLNVYDLSQGLARQLSQSLLGKVIEGVWHTGIVVYGNEYFFGGGIQHLPVGRTPYGAPIRTIELGLSHVPKD
VFEMYLEEISPRYTAESYNLLTHNCNNFSNELSQFLVGKGIPDYILQLPNDVLNSPMGGLIMPMLQGLETTLKAGAVPQV
PQFRPQPQPQPFGAFTKDEGPKFEKASKPEEANTSAATEKVPPVVPPSASEEKVKGDPLGDARTKIQEEITREFAALMAQ
GTLRASEAAAMATKRVMQKYGHLNVTA*

DNA
ATGGCTGAGGAAGCGCACAAGGTTACGTTGAATGTCTATGATCTAAGCCAAGGCTTAGCACGCCAGCTCTCGCAGTCACT
TTTGGGAAAGGTTATCGAAGGTGTATGGCATACAGGAATAGTTGTTTATGGAAATGAGTACTTTTTTGGAGGAGGAATAC
AGCATCTCCCTGTTGGAAGAACTCCATATGGAGCACCAATTCGAACTATAGAGTTGGGTCTATCACATGTTCCTAAAGAC
GTTTTTGAGATGTATTTGGAAGAAATCAGTCCTCGTTACACCGCTGAATCTTACAATTTACTTACTCACAACTGCAACAA
CTTCAGCAACGAGCTCTCTCAGTTTTTGGTGGGTAAAGGGATTCCAGACTACATTCTTCAGCTTCCCAATGACGTTCTTA
ACAGCCCCATGGGTGGTCTTATAATGCCTATGTTACAAGGCCTCGAAACAACTCTGAAAGCAGGTGCTGTTCCTCAAGTT
CCACAGTTTAGGCCACAGCCACAGCCACAGCCTTTTGGAGCTTTTACTAAAGATGAAGGTCCAAAATTTGAGAAAGCTTC
TAAGCCTGAGGAAGCAAATACCTCGGCTGCAACTGAAAAAGTGCCACCTGTTGTTCCACCGTCAGCTAGTGAAGAGAAGG
TGAAAGGGGACCCGTTGGGTGATGCTAGGACCAAGATTCAAGAAGAGATTACTCGTGAATTTGCAGCTTTGATGGCACAA
GGCACACTACGTGCAAGTGAAGCAGCTGCTATGGCGACAAAAAGAGTTATGCAAAAATACGGACATCTTAATGTAACTGC
TTAG