Details for Capsella Locus Carubv10014378m

Position : scaf_3 ( 5`- 1059896 .. 1061420 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014378m

Protein [Map View]
MTTTQSSISQPPLPLAGRVAIVTGSSRGIGRAIAIHLAELGARVVVNYTSKAADAERVATEINGFPVREEITGKGPRAIV
VQANVSEPSQVKAMFDAAESAFEAPVHILVNSAGVLDPKYPTIADTSVEEFDRIFSVNTKGAFLCSKEAANRLKQGGGGR
IILLTSSTTRSLRVGYGAYAASKAAVETMVKILAKELKGTGITANCVAPGPIATEMFFDGKTPELVEKIAAESPFGRVGE
AKDVVPLVGFLAGDGGEWVNGQIIPVNGGYV*

DNA
ATGACTACAACACAGTCGTCAATTTCGCAACCGCCGCTTCCACTCGCCGGACGAGTCGCCATCGTCACCGGCTCGTCCCG
TGGTATTGGCCGAGCGATAGCTATCCACCTCGCTGAACTCGGTGCGAGGGTTGTTGTCAACTACACCTCTAAAGCCGCGG
ACGCCGAGCGTGTAGCGACTGAGATCAATGGTTTCCCAGTTAGGGAAGAAATCACAGGAAAGGGTCCAAGAGCCATTGTG
GTTCAGGCCAATGTCTCCGAGCCAAGTCAGGTGAAAGCCATGTTTGATGCTGCGGAGAGTGCCTTTGAAGCGCCGGTTCA
CATTCTGGTTAACTCGGCTGGAGTTCTCGATCCCAAATACCCTACGATTGCTGACACCTCAGTCGAAGAATTCGACCGCA
TCTTCAGTGTCAATACAAAAGGAGCGTTCCTGTGCAGCAAAGAAGCTGCCAATAGGCTAAAACAAGGAGGAGGAGGTCGG
ATCATACTACTAACATCTTCCACAACCCGATCCTTGAGAGTGGGGTATGGTGCATACGCAGCATCAAAGGCAGCTGTGGA
AACCATGGTCAAGATCCTTGCAAAAGAGCTCAAAGGCACAGGGATCACTGCAAACTGTGTTGCTCCAGGACCCATTGCAA
CTGAGATGTTCTTTGATGGAAAGACCCCAGAGTTGGTTGAGAAGATAGCCGCAGAGTCTCCGTTTGGGAGGGTGGGTGAA
GCCAAAGACGTGGTGCCTCTTGTTGGATTCTTGGCAGGTGATGGTGGTGAATGGGTCAATGGACAAATCATTCCAGTTAA
TGGTGGATATGTGTAA