Details for Capsella Locus Carubv10014376m

Position : scaf_3 ( 5`- 3737223 .. 3740005 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014376m

Protein [Map View]
MSVNHYHHHNTLSLQQHQQHIHHQNDLSLAQRESLFEKSLTPSDVGKLNRLVIPKQHAEKYFALSNNNNNGGGGGGDDVA
TTEKGMLLSFEDESGKCWKFRYSYWNSSQSYVLTKGWSRYVKDKHLDAGDVVFFQRHRFDLQRLFIGWRRRGEASSSPGA
VSQEALAANTTAFWTPYRQVHASTTYPNIHHEYSHYGAAADQAQSTPTVVAGSSRTVRLFGVNLECHGDAVEPPPRTDGG
YSGQHIFYYSTPHPMDISFAGEALEQVGDGRG*

DNA
ATGTCAGTCAACCATTACCACCACCACAACACTCTCTCGTTGCAGCAGCACCAACAACATATACACCACCAAAACGACCT
CTCCCTTGCACAAAGAGAGTCTTTGTTCGAGAAATCCCTCACGCCAAGCGACGTCGGTAAGCTCAACCGCTTAGTCATAC
CAAAACAACACGCCGAGAAATACTTCGCTCTCAGTAATAATAATAATAATGGCGGCGGAGGAGGAGGGGATGACGTGGCG
ACGACGGAGAAAGGGATGCTTCTTAGCTTCGAGGACGAGTCAGGCAAGTGCTGGAAATTCAGATACTCTTATTGGAACAG
TAGCCAGAGCTACGTGTTGACCAAAGGGTGGAGCAGGTACGTCAAAGACAAACACCTCGACGCAGGCGACGTCGTCTTCT
TCCAGCGACACCGTTTCGATCTCCAAAGACTCTTCATTGGCTGGCGGAGACGCGGCGAGGCTTCTTCCTCTCCCGGCGCC
GTGTCTCAAGAAGCTTTGGCCGCGAATACGACGGCGTTTTGGACACCTTATCGTCAAGTACACGCGTCAACTACTTACCC
TAATATTCACCATGAGTATTCACACTACGGCGCCGCCGCTGATCAGGCTCAGTCGACACCGACTGTGGTCGCAGGGAGCT
CGAGGACGGTGAGGCTCTTTGGCGTTAACCTCGAATGTCACGGTGACGCTGTCGAGCCACCACCACGTACCGACGGCGGC
TACAGCGGCCAACACATTTTCTATTACTCAACTCCTCACCCCATGGATATATCATTTGCTGGGGAAGCATTGGAGCAGGT
AGGAGATGGACGAGGTTGA