Details for Capsella Locus Carubv10014373m

Position : scaf_3 ( 5`- 9147244 .. 9149083 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014373m

Protein [Map View]
MVVNQNISGLASAMNAKIIGSGERTMILAHGFGGDQSVWDKMIPVLSQSFKILVFDWLFSGAVKDQTLYDPSKYNSLDAF
SDDLIALMEELKFGPVVFVGHSMSGMIGCAASIKRPDLFTSLLLVGASPRYINCEDYEGGFESKDIDTIISNIGSNYEAW
AVAFSSIVVDPRDSDSVQRFEKCLKKMKPETALAIAKIVFGSDERELLGQVSVPCHVIQTGNDVVVPVSVAYFMQEKIKG
NSTVEIIEDAIGHFPQMTSHLELLGVMRRLLEF*

DNA
ATGGTGGTTAATCAGAATATATCCGGCCTTGCATCCGCTATGAACGCCAAAATCATCGGTTCTGGCGAGAGAACAATGAT
CTTGGCACACGGTTTTGGAGGCGACCAGTCGGTTTGGGACAAGATGATACCGGTCTTGTCCCAATCTTTCAAAATCTTGG
TCTTTGACTGGCTTTTCTCTGGAGCCGTTAAAGACCAAACTCTTTATGACCCTTCAAAGTATAACTCTTTAGATGCTTTC
TCAGATGATCTTATTGCTCTTATGGAGGAGTTGAAGTTTGGTCCGGTCGTTTTCGTAGGCCATTCCATGTCGGGTATGAT
CGGTTGTGCTGCTTCTATTAAAAGGCCCGACTTGTTTACAAGTCTTCTTCTCGTTGGTGCTTCTCCCAGGTACATAAACT
GTGAGGACTACGAAGGAGGGTTTGAGTCAAAAGACATCGACACAATCATCTCAAACATTGGCTCCAACTACGAAGCATGG
GCGGTTGCTTTCTCATCCATCGTGGTCGACCCGAGAGATTCTGACTCAGTCCAAAGGTTTGAGAAGTGCCTTAAGAAGAT
GAAGCCCGAGACGGCTCTTGCCATAGCTAAGATAGTTTTTGGTAGCGACGAGAGAGAGCTCTTGGGACAAGTGTCAGTGC
CTTGTCACGTCATACAGACTGGAAACGACGTCGTGGTGCCTGTCTCCGTCGCGTACTTCATGCAGGAGAAGATTAAAGGG
AACTCGACGGTGGAGATCATCGAAGACGCCATCGGGCATTTTCCACAGATGACCTCGCATTTGGAACTGCTTGGTGTCAT
GAGGCGTCTCCTCGAGTTTTAA