Details for Capsella Locus Carubv10014343m

Position : scaf_3 ( 5`- 1536932 .. 1539055 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014343m

Protein [Map View]
MMSGGNYTTIDSQKVSGSVPSVPDPGHTTVKFAESNLQTFPPSATQGKISGGSNPPRDADDSFSGQGNGSTDEPQSGGWL
HKFTVGAYKPFFDVDTSDVVERLKESLFPFRGTFTEKTADKPDLYGPFWICTTLIFVAASIGTFVTYIAHKWKKQEWNYD
INLVTWSAGVFYGYVTIVPLALYVVLKYFSAPSGLVQLFCLYGYSLFVFIPALCLSVVPVEIFRWVIAGVAGFMSATFVA
LNLKAHINSAGERSILIIASIFLLQLALAVVLKLYIFNVKV*

DNA
ATGATGTCCGGTGGGAACTACACGACTATCGACAGCCAGAAAGTCTCTGGATCTGTTCCTTCTGTTCCAGATCCAGGCCA
TACCACCGTCAAATTCGCAGAATCAAATCTACAAACTTTTCCTCCATCTGCTACTCAAGGCAAGATCTCTGGTGGTAGTA
ATCCCCCTCGAGATGCTGATGATTCATTCTCTGGGCAAGGTAATGGTAGTACAGATGAACCTCAGTCTGGTGGCTGGCTT
CACAAATTCACTGTTGGTGCTTACAAGCCATTCTTTGATGTCGACACTTCGGATGTCGTAGAGAGGCTCAAAGAATCTCT
CTTCCCATTCCGTGGAACATTTACAGAGAAGACAGCTGATAAGCCTGACTTGTATGGTCCATTCTGGATATGTACGACTT
TGATATTCGTTGCAGCATCTATCGGCACGTTTGTCACATACATAGCACACAAATGGAAGAAACAAGAATGGAACTACGAT
ATTAATCTGGTGACTTGGTCTGCAGGAGTGTTCTATGGATATGTCACGATTGTTCCTCTTGCGCTATATGTCGTTCTAAA
ATACTTTTCTGCCCCATCAGGCCTAGTCCAACTCTTCTGTCTCTATGGCTATTCCCTGTTTGTCTTTATACCAGCATTGT
GCCTCTCGGTCGTGCCAGTGGAGATATTCAGATGGGTGATCGCGGGAGTAGCCGGGTTCATGTCTGCAACATTTGTGGCT
CTGAACCTCAAAGCACATATCAATTCCGCTGGAGAGAGGTCGATCCTGATAATCGCCAGCATCTTTCTTTTGCAGCTGGC
GCTAGCAGTTGTGCTGAAGCTCTATATCTTCAATGTCAAAGTATGA