Details for Capsella Locus Carubv10014342m

Position : scaf_3 ( 5`- 7942536 .. 7945080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014342m

Protein [Map View]
MAESSSPSPTEEIVRLIKRLSAYVAFKMSSLFSTTSIRNLDSRSIGAIAGLAIAVIFTWRAIRTPGEQRQRRQPKRRMQS
PESSSAAAAAQSNLASVPPEVSSPHEDNAVQDVVDQFFQPVKPTLGQIVRQKLSEGRKVTCRLLGVILEETSPEELQKQV
TVRSSVLEVLLEITKFSDLYLMERVLDDESEARVLEALESAGIFTSGGLVKEKVLFCSTEIGRTSFVRQLEPDWHIDTNP
EINTQLSRFIKYQLQVAAVKPERIAPNVFTSQSIEQFFGCV*

DNA
ATGGCGGAATCGTCTTCGCCGTCGCCTACTGAAGAGATCGTCCGGTTGATTAAGCGTTTAAGCGCTTACGTTGCTTTCAA
AATGTCAAGCCTCTTCTCAACTACATCGATTCGAAATCTGGATTCAAGATCTATTGGTGCGATTGCGGGGCTGGCGATTG
CGGTGATATTCACGTGGAGGGCGATTAGAACGCCAGGGGAACAACGGCAAAGAAGGCAGCCGAAGCGGAGGATGCAATCC
CCTGAATCGTCTAGTGCTGCTGCTGCTGCTCAGTCGAATCTAGCTTCTGTACCTCCTGAGGTTTCTTCGCCTCATGAGGA
TAATGCGGTGCAAGATGTTGTTGATCAGTTCTTTCAACCTGTTAAACCTACTTTGGGGCAAATAGTTAGGCAGAAGCTTA
GTGAAGGAAGGAAGGTAACATGCCGTCTTCTTGGAGTAATTCTTGAAGAAACAAGTCCAGAAGAACTCCAAAAACAAGTG
ACAGTGAGGTCATCTGTTTTGGAAGTTCTCCTAGAGATTACAAAGTTTAGTGATTTATACCTCATGGAAAGAGTACTTGA
CGATGAAAGCGAAGCCAGAGTTCTAGAAGCTTTAGAAAGTGCAGGCATTTTCACATCTGGTGGTTTGGTCAAAGAAAAGG
TTCTCTTTTGTAGTACAGAGATCGGAAGAACTTCATTTGTCAGACAACTAGAACCTGACTGGCATATCGATACAAATCCA
GAAATCAACACACAACTATCTAGGTTCATCAAATATCAGCTTCAAGTCGCTGCCGTGAAACCGGAGCGAATAGCTCCAAA
TGTGTTCACCTCGCAGTCAATAGAACAGTTCTTTGGATGTGTTTGA