Details for Capsella Locus Carubv10014330m

Position : scaf_3 ( 5`- 1589596 .. 1591201 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014330m

Protein [Map View]
MSLKPYFSLRLHSSLPTNSKLSNFFIAQQPSGDRKTTPAEEFSFLAERFNRRLLLGVGSSSVLAVGANFGGITSFLLGLS
PELGRNLKLDVVYPIGGYSRCVDSVEGFEFIYPATWVGDQTLLYRAAEKSERETSLDLPPARISSRRKNVNEPVVAFGPP
GSTGELNVSVIVSPVSPTFSIEAFGGPKEVGEAIVRTVTGSGQRTDLKGTLLESNLRQDSERNLKYYELEFKVESPVFRR
HNVAICCAHGGRLYTLNAQAPESAWSEVRSEIYTTAKSFNIIS*

DNA
ATGTCTCTGAAACCTTACTTCTCTCTACGACTACACTCATCACTGCCTACAAATTCTAAACTCTCCAACTTCTTCATCGC
TCAGCAACCCTCCGGCGACCGCAAAACTACCCCGGCCGAGGAGTTTTCTTTTCTAGCTGAGAGATTCAACCGTCGCCTTC
TTCTGGGTGTAGGCTCGTCCTCTGTTCTTGCCGTCGGTGCTAATTTCGGTGGTATCACTAGCTTTTTACTCGGTTTATCG
CCGGAACTCGGCCGGAATTTGAAACTCGACGTCGTCTATCCGATTGGAGGTTATAGCAGATGTGTCGACTCGGTTGAAGG
ATTCGAATTTATATATCCGGCTACGTGGGTTGGAGACCAGACGCTTTTGTATAGAGCGGCGGAGAAGTCTGAACGTGAGA
CATCGCTAGACCTTCCTCCGGCAAGAATCAGTAGTCGCCGTAAAAACGTTAATGAGCCGGTTGTTGCTTTTGGACCTCCC
GGTTCGACCGGCGAGCTCAACGTCAGTGTTATCGTCTCCCCTGTCTCACCCACTTTCTCGATCGAAGCATTTGGAGGGCC
AAAAGAAGTAGGAGAAGCAATAGTAAGAACGGTGACAGGATCTGGTCAACGAACAGATTTAAAAGGAACTTTGCTGGAAT
CAAATCTCAGACAAGATTCAGAGAGAAACTTGAAGTACTATGAGTTGGAGTTTAAAGTTGAATCCCCCGTTTTCCGGCGG
CATAATGTAGCCATTTGCTGTGCTCACGGTGGCCGGCTTTATACGCTGAACGCTCAAGCTCCAGAGTCAGCTTGGTCGGA
GGTGAGATCAGAGATTTACACTACTGCTAAATCGTTCAACATCATTTCTTGA