Details for Capsella Locus Carubv10014306m

Position : scaf_3 ( 5`- 618740 .. 620514 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014306m

Protein [Map View]
MESAPTGCFKCGRPGHWSRDCPSSAPVAGNNTVSSSSAPSQIPSNDYQRSSKKSGTSVGPVPKVTKTKVQRPKLTPELLL
SEDGLGYVLRYFPKSFKYRGRGKEVSDLGNLIRLYSEWHSHLLPYYSFDQFVHKVQQVASTKRVKNCINELRERVASGVD
PNKLYEKPEDNTGPYDDQGNLDTDQPSHDEENIPSKSTDVDADADANVDAFQDSMLNEIFDNASRLPGDEQNMDKSRELT
EEQRERMEANRLKAMEKAQNISEEQRVRMEANRLKALERAKARLQPNQD*

DNA
ATGGAATCAGCTCCGACGGGATGTTTCAAGTGTGGCCGTCCCGGTCACTGGTCTCGCGATTGCCCATCATCGGCTCCGGT
CGCCGGCAATAATACCGTTTCTTCTTCTTCCGCTCCATCTCAGATCCCTAGTAATGACTATCAGAGATCCTCCAAGAAAA
GTGGAACCTCCGTAGGGCCTGTTCCTAAAGTGACGAAGACGAAAGTTCAAAGGCCCAAGCTTACTCCTGAATTGCTTCTC
TCTGAGGATGGCCTCGGCTATGTTCTTCGCTATTTCCCTAAATCCTTCAAGTATCGTGGCCGTGGCAAAGAGGTGAGCGA
TTTGGGAAATTTGATACGGCTGTACAGTGAGTGGCACTCTCATTTGCTACCTTATTATTCCTTTGATCAATTTGTGCATA
AAGTGCAACAAGTCGCTTCTACTAAACGTGTCAAGAATTGTATAAACGAACTGCGAGAAAGGGTTGCCAGCGGAGTTGAT
CCAAACAAGTTATACGAAAAGCCGGAAGACAATACTGGTCCTTATGATGATCAAGGTAACCTAGATACGGATCAGCCAAG
TCATGACGAAGAGAACATACCATCGAAGAGCACTGATGTTGACGCTGATGCTGATGCCAATGTTGATGCTTTTCAAGACA
GTATGTTGAATGAGATCTTTGATAATGCTTCGAGGCTACCGGGAGATGAACAAAACATGGATAAAAGCAGGGAACTGACA
GAAGAGCAAAGAGAACGTATGGAAGCAAATAGATTGAAGGCAATGGAGAAAGCTCAGAACATTTCCGAGGAACAGAGAGT
ACGTATGGAAGCTAATAGACTAAAGGCTCTCGAAAGAGCCAAAGCAAGGCTTCAACCCAATCAAGATTAG