Details for Capsella Locus Carubv10014303m

Position : scaf_3 ( 5`- 7867280 .. 7869107 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014303m

Protein [Map View]
MAQSCLKIVRINNLRNRVNRRILILRRFTRLLWSRIVACTPGKSRRYLLLSRALPSPIVSRPSPSPPPIPAVDVIDGGEF
VRRSSVVYDHDNGHHRRSDSDLVSLKISLLGDPEIGKTSFLAKYVGEEKEVEMIELEKGINCTDKTLYMGGARISYSIWE
LEGAERSRDQIPMACKDSVAILFMFDLTSRCTLNSVISWYQQARKSNQTAIPVMVGTKFDEFIQLPIDLQWTIASQARTY
AKALNATLFFSSASYNINVNKIFKFVTAKLFDLPWTVERNLTIGEPIIDF*

DNA
ATGGCTCAATCTTGTCTTAAAATTGTTCGGATCAACAATCTAAGGAACAGAGTGAATCGTCGGATTTTGATTCTCCGACG
ATTCACTCGTTTGTTATGGAGCAGGATCGTCGCTTGTACTCCTGGTAAATCCAGGAGATATCTGTTGCTTTCTCGCGCTC
TTCCTTCTCCCATTGTTTCTCGTCCTTCTCCTTCTCCTCCTCCCATCCCCGCCGTGGATGTCATTGATGGCGGCGAGTTT
GTTCGTCGTTCTTCCGTGGTTTATGATCACGATAATGGTCATCATCGGAGATCGGATTCTGATCTTGTCTCTTTGAAGAT
TAGTCTCTTAGGTGATCCAGAAATCGGAAAAACTAGCTTCCTGGCGAAATATGTTGGTGAAGAGAAAGAAGTGGAAATGA
TAGAATTGGAGAAAGGGATCAATTGTACGGACAAGACGTTATACATGGGAGGAGCTCGCATTTCATATAGTATTTGGGAA
TTAGAAGGGGCTGAGAGATCAAGGGATCAGATCCCAATGGCTTGCAAGGACTCTGTAGCCATTCTCTTTATGTTTGATCT
AACCAGTCGTTGCACGCTTAATAGTGTGATTAGCTGGTATCAACAAGCTAGGAAGTCTAATCAGACGGCGATTCCAGTTA
TGGTAGGAACCAAGTTTGATGAGTTTATTCAGCTTCCTATTGATCTGCAATGGACTATTGCTAGCCAGGCGAGAACATAT
GCGAAGGCGCTAAACGCGACGCTCTTCTTCTCGAGTGCTTCTTATAACATAAACGTGAATAAGATCTTCAAGTTTGTGAC
GGCGAAGCTGTTTGATCTGCCATGGACGGTGGAGCGGAACCTTACTATCGGAGAACCAATCATCGACTTCTAG