Details for Capsella Locus Carubv10014292m

Position : scaf_3 ( 5`- 8241192 .. 8242699 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014292m

Protein [Map View]
MSFEEDIVSDDEMNMIDEDVETDSEAESLSDSETENEITEKLAEPTKTAVYNRAGLLDKLQDISWPEDVDWIHKLTLDID
LGQAVDVNDDLARESALYNQALQGTREGYAKFEDMNLLFLRPANYYAEMVKSDTHMEKVKSRLLHEKKQMEESEERRKAR
DNKRMAKEVQSQKMKERAKQKKDDIESVKKWRKQRQQSGFSDKAGEPELDFESGKSFQRGGGKKRPGVSPGDRSGGKGKP
TSRMNNKKREFRDSKFGHGGRKGLSKQNTAETTNDFKGGFRGGKASGNKRQKR*

DNA
ATGTCGTTTGAAGAGGATATAGTATCAGATGATGAGATGAACATGATTGATGAGGATGTAGAGACTGACTCTGAAGCAGA
ATCTCTTTCGGATTCAGAAACAGAGAACGAGATAACAGAGAAATTGGCTGAGCCTACCAAGACTGCTGTATACAACAGAG
CTGGGTTGCTTGATAAACTTCAAGATATTAGTTGGCCTGAAGATGTTGATTGGATTCATAAGCTTACGCTTGACATTGAC
CTGGGACAAGCTGTAGATGTGAACGATGACCTTGCGAGGGAGTCGGCTCTCTACAATCAAGCTCTTCAAGGGACAAGAGA
AGGGTATGCGAAATTCGAAGATATGAATTTGCTTTTCCTCAGGCCTGCGAATTACTATGCGGAGATGGTGAAATCTGATA
CTCATATGGAGAAAGTGAAGTCTCGGCTATTGCACGAGAAGAAACAGATGGAGGAGTCTGAAGAGAGGAGGAAGGCTAGG
GATAATAAGAGAATGGCTAAGGAGGTACAGTCTCAGAAGATGAAGGAACGTGCGAAGCAGAAGAAGGATGATATTGAGTC
TGTGAAGAAGTGGAGGAAACAGAGGCAGCAGAGCGGTTTTAGTGATAAAGCTGGTGAGCCTGAACTTGATTTTGAAAGTG
GAAAGAGTTTCCAGAGGGGAGGAGGTAAGAAAAGACCAGGTGTGTCTCCCGGTGATCGATCAGGAGGCAAAGGAAAGCCT
ACTTCGAGGATGAACAACAAGAAGAGGGAGTTTCGGGATTCCAAGTTTGGTCATGGTGGTAGGAAGGGTTTGAGCAAGCA
GAACACAGCAGAGACAACAAATGATTTCAAAGGCGGATTTCGTGGTGGAAAAGCCAGCGGAAACAAGAGGCAGAAGAGGT
AG