Details for Capsella Locus Carubv10014289m

Position : scaf_3 ( 5`- 7514967 .. 7519129 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014289m

Protein [Map View]
MHSKSDTGNKIDSEAHRTSPSSINSVNPWQRAAAACDANSNVEAGDKPSKSIALESNGPKSPSGRDDNANKESNVTTSPS
SAGEYSDKNQEPLHPCITQPPHPQLVGHTVGWTSSNPYQDPYYAGVMGAYGHHPLGFVPYGGMPHSRMPLPPEMAQEPVF
VNAKQYQAILRRRQARAKAELEKKLIKSRKPYLHESRHQHAMRRPRGTGGRFAKKTKTEASQRKAEEKSNGCVTQSPTSS
NSDQAEAWNVEYRKPQGDDMQSSAYNRREEGECSGQQWNSLSSNHPSQARLAIK*

DNA
ATGCATTCAAAATCTGACACTGGGAACAAGATTGATTCAGAGGCTCATCGTACATCGCCGTCTTCTATAAATAGTGTAAA
CCCTTGGCAGCGTGCTGCAGCTGCTTGCGATGCAAATTCTAATGTGGAAGCTGGAGATAAACCTTCGAAGTCTATAGCTT
TGGAATCAAATGGTCCGAAATCACCTTCCGGTAGAGATGATAATGCGAACAAGGAATCAAATGTGACAACTTCTCCGAGT
TCAGCTGGAGAGTACAGTGATAAAAATCAAGAACCTTTGCATCCCTGCATCACACAACCTCCTCACCCTCAACTTGTTGG
CCACACAGTTGGATGGACATCCTCAAATCCATACCAGGATCCTTATTATGCAGGAGTGATGGGAGCCTATGGACATCATC
CTTTGGGTTTTGTTCCATACGGTGGGATGCCTCATTCAAGAATGCCACTGCCTCCTGAGATGGCTCAAGAACCAGTTTTC
GTGAATGCTAAACAGTACCAGGCGATTCTGAGGCGAAGGCAGGCACGTGCCAAGGCAGAGCTAGAGAAGAAGCTAATAAA
ATCCAGAAAGCCTTATCTCCATGAATCTCGGCATCAACATGCTATGAGGAGGCCAAGGGGTACTGGAGGACGGTTTGCAA
AGAAAACCAAGACCGAAGCTTCACAGCGCAAAGCTGAAGAAAAGAGCAATGGTTGTGTTACTCAGTCCCCAACGTCATCT
AATTCTGATCAAGCTGAAGCATGGAATGTTGAGTATAGAAAACCTCAGGGCGATGACATGCAGAGCTCAGCTTATAATAG
AAGGGAAGAAGGAGAGTGTTCAGGGCAGCAATGGAACAGCCTTTCCTCAAACCATCCTTCCCAAGCTCGCCTAGCCATCA
AATGA