Details for Capsella Locus Carubv10014285m

Position : scaf_3 ( 5`- 13423454 .. 13425489 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014285m

Protein [Map View]
MAELPGQIRRMGGGISQLLEQICGFSRRCLFQVISMGPIPNHLAFIMDGNRRYAKKCGLEDGSGHKAGFSALMLMLQYCY
ELGIKYVTIYAFSIDNFRRQPEEVQSLMDLMLEKINSLLEKESIVHQYGIRVYFIGNLALLNDQVRVAAEKVMKATAKNS
RVVLLICIAYNSTDEIVQAVKKSCINKSDNIKASGNYKHEDADSDVERKDMENQEERIQLVDIEENMQMSVAPNPDILIR
SSGEARLSNFLLWQTGNSQLCSPAALWPEIGLRHLVWAILNFQRSHSYLEKRKKQL*

DNA
ATGGCTGAACTTCCGGGTCAAATAAGACGTATGGGCGGTGGAATTAGCCAACTGCTCGAACAGATATGTGGGTTTTCGAG
AAGATGTTTGTTTCAGGTCATATCTATGGGTCCTATACCTAATCATCTCGCTTTTATCATGGATGGAAATCGGAGATATG
CAAAGAAGTGTGGTCTTGAAGACGGATCTGGTCATAAAGCTGGGTTTTCTGCCCTTATGTTGATGCTACAATACTGCTAC
GAGCTGGGTATTAAGTATGTTACGATATACGCTTTTAGCATAGATAATTTTAGAAGACAACCTGAGGAGGTTCAGTCTCT
AATGGATTTGATGCTGGAAAAGATTAATTCCTTGCTTGAGAAAGAGAGTATTGTTCATCAGTATGGGATTCGGGTCTATT
TTATTGGTAACTTGGCGCTTCTGAATGACCAAGTGAGAGTTGCTGCAGAAAAAGTCATGAAGGCCACAGCCAAGAATAGT
CGGGTAGTGCTTCTCATCTGCATTGCCTATAACTCGACAGATGAGATCGTACAAGCTGTCAAGAAATCTTGTATTAACAA
GTCAGACAATATTAAAGCGTCTGGTAATTATAAACATGAGGATGCAGATAGTGATGTAGAAAGAAAGGATATGGAGAACC
AAGAGGAAAGGATTCAATTGGTAGATATTGAGGAGAATATGCAGATGAGCGTTGCTCCGAATCCTGATATACTTATCAGG
AGTTCAGGAGAGGCGAGGTTGAGCAACTTTCTCTTATGGCAAACAGGTAATTCCCAGCTCTGCTCTCCGGCTGCTCTGTG
GCCTGAGATCGGTCTGAGGCATTTGGTCTGGGCTATATTGAACTTCCAAAGAAGCCATTCATACTTGGAAAAGAGGAAGA
AACAATTGTGA