Details for Capsella Locus Carubv10014265m

Position : scaf_3 ( 5`- 2442319 .. 2446342 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014265m

Protein [Map View]
MASQPAGGSPPKPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSVNRTNTAANMNALSRPVPTRPWEQQSYG
TTMGGYGSNLGVNSGYGSGTYGSALGGYGGGMYGGSSMYRGGYGGAGGLYGSSGMYGGGGMYNSSYGGTMGGYGMGMGSG
MGMGMGMGMGMGPYGGQDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVAMLIDQNTQAFHMFMSALLQLFDRGGMLYG
ELARFVLRMLGVRTKPRKMQQPPQGPNGLPLPHQPHGNQNYIEGPKTAVPGGGGGWDNVWGN*

DNA
ATGGCGTCTCAGCCAGCAGGTGGCAGTCCTCCTAAACCTTGGGAACAAGAAGGAAATACATCTGGTCCTAATCCTTTCAG
GCCTCCTTCGAATACTAGCACGGCTGGTTCAGTTGAGGCTTCTGGCACAGCCAATCCCGGTGAAGTAGTTTCATCCGTGA
ACAGAACTAATACAGCTGCTAATATGAATGCACTGAGTAGGCCTGTACCGACTAGACCTTGGGAGCAGCAGAGTTATGGG
ACCACAATGGGAGGTTATGGTTCCAATCTAGGTGTGAACTCTGGGTATGGGTCAGGTACATATGGTTCAGCATTAGGTGG
GTATGGTGGTGGAATGTATGGTGGTAGTAGTATGTATAGAGGAGGTTACGGTGGTGCTGGTGGTCTATATGGAAGCTCAG
GCATGTATGGTGGTGGTGGGATGTACAACAGCAGTTATGGTGGCACGATGGGTGGTTATGGTATGGGTATGGGATCAGGA
ATGGGAATGGGAATGGGAATGGGGATGGGAATGGGTCCCTATGGTGGTCAAGATCCGAATGACCCTTTTAATCAACCTCC
ATCTCCACCAGGCTTTTGGATATCATTTCTCCGTGTGATGCAAGGTGCTGTGAATTTCTTTGGCCGTGTAGCAATGCTTA
TAGATCAAAACACTCAGGCCTTTCACATGTTCATGTCTGCGCTTCTTCAGCTATTTGATCGTGGTGGTATGTTATATGGA
GAATTAGCAAGATTTGTATTGCGTATGCTTGGGGTGAGAACAAAGCCTAGAAAGATGCAGCAGCCACCACAGGGGCCTAA
CGGACTCCCTTTACCCCACCAGCCACATGGAAACCAGAACTACATCGAGGGGCCTAAAACTGCTGTACCAGGTGGTGGTG
GTGGTTGGGACAATGTATGGGGCAACTAA