Details for Capsella Locus Carubv10014252m

Position : scaf_3 ( 5`- 6332763 .. 6334989 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014252m

Protein [Map View]
MSQPSVILATASYDHTIRFWEAETGRCYRTIQYPDSHVNRLEITPDKRYLAAACNPHIRLFDVNSNSPQPVMTYDSHTNN
VMAVGFQCDGKWMYSGSEDGTVKIWDLRAPGCQKEYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANSCSCELVPE
VDTAVRSLTVMWDGTMVVAANNRGTCYVWRLLRGKQTMTEFEPLHKLQAHNGHILKCLLSPANKYLATASSDKTVKIWNV
DGFKLEKVLTGHQRWVWDCVFSVDGEFLVTASSDMTARLWSMPAGKEVKVYQGHHKATVCCALHD*

DNA
ATGAGTCAGCCTTCTGTGATTCTTGCCACGGCTAGCTATGATCACACGATCCGATTCTGGGAAGCCGAAACTGGACGATG
TTACCGTACCATTCAGTACCCTGATTCGCATGTAAATAGATTGGAGATAACCCCAGATAAGCGTTATCTAGCAGCAGCTT
GCAATCCTCATATACGACTCTTTGATGTCAATTCCAACAGCCCCCAACCTGTGATGACCTATGATTCACATACCAACAAT
GTTATGGCAGTAGGATTCCAATGTGATGGGAAATGGATGTACTCAGGATCAGAGGATGGCACAGTTAAGATTTGGGACTT
GAGGGCTCCGGGTTGCCAAAAGGAGTATGAAAGTGTTGCTGCAGTTAACACAGTTGTTCTACACCCAAATCAGACTGAAT
TGATATCTGGAGACCAAAATGGAAATATACGTGTATGGGATCTCAGAGCAAATTCGTGTAGCTGTGAACTGGTACCAGAA
GTTGATACTGCTGTACGATCTTTAACTGTTATGTGGGATGGGACAATGGTGGTTGCTGCTAACAACCGTGGAACATGTTA
TGTATGGCGCTTGCTGCGTGGAAAGCAGACAATGACCGAGTTTGAGCCGCTTCATAAGCTACAAGCGCATAATGGTCACA
TCCTCAAATGTCTCCTCTCGCCTGCAAACAAATATCTAGCGACCGCATCATCTGATAAAACCGTCAAAATATGGAACGTC
GATGGTTTCAAATTAGAGAAAGTTTTAACAGGACATCAAAGATGGGTCTGGGACTGCGTATTTTCAGTGGATGGTGAATT
TCTTGTGACAGCATCATCGGACATGACGGCTAGATTGTGGTCGATGCCAGCGGGAAAAGAAGTGAAGGTCTACCAAGGTC
ATCATAAAGCTACTGTGTGTTGTGCACTCCACGATTAA