Details for Capsella Locus Carubv10014249m

Position : scaf_3 ( 5`- 4615682 .. 4617100 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014249m

Protein [Map View]
MEIEGEDGAKLFLKAGVKSVFGRGAGFNTGDLTVSRRHVSFELKPAAAGTERSESDRVYFEVLGRNPVWVKTGELGEKIR
TFRKSETGEIAGGDRFCVSGHNPIWFTLENCDEVMEERRTLDSESEFGIIEISDIDPVKEFGFLVIGKEFDQYPKSRMRD
IKQWEWFLEDSTNGRNSDDDDGDKKRRKGLGKKRSRKKGNEDDDWSVESDEDKELMVKSKRVMVTPAYSTRSKKKTKNDT
NASSSGTQTKQRGGVDFEDDDDETLGGFIVSDEEDKLEENDESNVEEEEEEEEEEEGLDEDEDEE*

DNA
ATGGAAATCGAAGGTGAAGACGGCGCGAAGCTCTTCCTGAAGGCCGGAGTAAAGTCTGTGTTCGGAAGAGGAGCGGGATT
CAACACCGGAGACCTAACAGTGTCACGCCGCCACGTCTCGTTCGAGTTAAAACCCGCCGCCGCCGGAACCGAACGGTCCG
AATCCGATAGGGTTTACTTCGAGGTTCTCGGGAGGAATCCAGTCTGGGTTAAGACGGGTGAACTCGGCGAAAAGATTCGA
ACTTTCCGGAAATCTGAGACGGGAGAGATCGCCGGCGGCGATCGATTTTGTGTATCGGGTCATAACCCAATTTGGTTCAC
TTTGGAGAATTGCGATGAAGTTATGGAAGAGAGAAGAACATTGGATAGTGAAAGCGAATTTGGTATTATAGAAATCTCAG
ATATCGACCCTGTTAAAGAGTTTGGATTTCTTGTGATTGGGAAAGAGTTTGATCAGTACCCAAAGAGTAGGATGCGTGAC
ATAAAGCAATGGGAATGGTTTTTAGAAGATTCCACGAATGGAAGAAATAGCGATGATGATGATGGAGATAAGAAGAGAAG
GAAAGGATTAGGCAAAAAGAGAAGTAGAAAGAAAGGGAATGAGGACGATGATTGGAGTGTTGAAAGTGATGAAGATAAAG
AGTTGATGGTGAAATCCAAAAGAGTTATGGTGACTCCTGCTTACTCGACCAGATCCAAGAAGAAGACGAAGAACGATACA
AACGCAAGTAGTAGTGGTACTCAAACGAAACAGCGTGGAGGTGTAGATTTCGAAGATGACGATGATGAAACATTGGGAGG
CTTCATTGTTAGTGATGAAGAAGATAAGTTAGAAGAAAATGACGAATCAAATGTAGAAGAAGAAGAAGAAGAAGAAGAAG
AAGAAGAAGGTCTTGATGAAGATGAAGACGAAGAGTAA