Details for Capsella Locus Carubv10014245m

Position : scaf_3 ( 5`- 5808612 .. 5810128 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014245m

Protein [Map View]
MTSNDRDSLPLGRPGDEFSGSKTYAMSGKIMLSAIIILFFVVILMVFLHLYARWYLLRARRRHLRRRSRNRRATMVFFTA
DPSAAAASSVVASRGLDPNVIKSLPVFTFSDETHKDPIECAVCLSEFEESESGRVLPNCKHTFHVDCIDMWFHSHSTCPL
CRALVEPLAGIELTATTTAEEQVVIAIDSDPVLVTEPGSSSGLRCEPNGSGSSPTPTDNSGRKPTAIEVPRRNFSEIEDE
LTRRESPASHSFRSPMSRMLSFTRMLSRDRRSASSPIAGATPLSPSSTCRIPVTESDIERGVEETR*

DNA
ATGACCAGCAACGACCGTGATTCGCTTCCGTTAGGCAGACCCGGAGACGAGTTCTCCGGTTCTAAAACATACGCCATGAG
CGGCAAAATCATGCTCAGCGCGATTATAATCCTCTTCTTCGTCGTCATTTTGATGGTCTTCCTCCATCTCTACGCCCGTT
GGTATCTCCTCCGTGCTCGTAGACGTCATCTCCGCCGTCGTAGCCGTAACCGCCGCGCTACTATGGTTTTCTTCACCGCT
GATCCTTCCGCCGCCGCCGCTTCTTCCGTCGTCGCTTCGCGTGGACTCGATCCGAACGTCATTAAATCTCTCCCCGTGTT
TACGTTTTCCGACGAGACTCATAAAGATCCGATCGAATGCGCCGTTTGTTTGTCGGAGTTCGAAGAGAGCGAATCGGGTC
GGGTTTTGCCCAATTGCAAACATACGTTTCATGTTGATTGCATCGACATGTGGTTTCATTCTCATTCCACTTGTCCTCTC
TGTCGCGCTCTCGTTGAGCCTCTCGCCGGGATTGAATTAACGGCGACGACGACGGCTGAGGAGCAAGTTGTGATTGCGAT
CGATTCTGATCCGGTTTTGGTTACTGAACCGGGTTCGAGCTCCGGATTGAGGTGCGAGCCAAATGGTTCTGGATCTTCTC
CGACGCCGACTGATAATTCCGGGAGAAAACCGACGGCGATTGAGGTTCCGAGGAGGAACTTCAGCGAGATAGAAGACGAG
TTGACTCGGAGAGAATCGCCGGCGAGTCACTCGTTTAGATCGCCGATGAGTCGGATGTTATCTTTCACTAGGATGTTGAG
TAGAGATAGAAGAAGCGCTTCGTCTCCTATCGCCGGAGCTACGCCGCTATCTCCGTCGTCGACCTGCCGGATACCGGTGA
CAGAGTCGGATATTGAGCGGGGAGTAGAGGAGACTCGGTGA