Details for Capsella Locus Carubv10014220m

Position : scaf_3 ( 5`- 4787663 .. 4792310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014220m

Protein [Map View]
MAALIRCCSSFSQTSGGQPLPRHKSQGPAISPLLFSRLGNLLVRKPGDHHPFSKIIHSSSQPKECEGRGVLQTPFSSVEK
LSTFEGIGRLKLPVMALLFTNSLQMATPLEALAAETCEPESSMFSMPILLLVALIGATVGGLLARQRKGELQRLNEQLRQ
INAALRRQAKIESYAPSLSYAPVGARIPESEIIVDPKKHELISKLKTGKTFLRNQEPEKAYAEFKIALELAQSLGDPTEE
KKAARGLGASLQRQGKYREAIQYHSMVLAISKREGEDSGTTEAYGAIADCYTELGDLEKAGNFYDTYIARLETD*

DNA
ATGGCGGCGCTTATCCGGTGTTGCTCCTCCTTCTCCCAGACTTCCGGTGGCCAACCACTGCCCCGCCACAAGTCTCAAGG
TCCAGCCATTTCGCCATTGCTTTTTTCAAGGCTTGGAAATTTACTAGTCAGGAAACCTGGGGATCATCATCCTTTCTCCA
AAATTATACATTCGTCTTCTCAGCCCAAGGAGTGCGAGGGCAGAGGAGTCTTACAGACACCATTTTCCAGTGTGGAAAAG
TTGTCAACTTTTGAGGGAATTGGCAGGCTCAAATTACCGGTGATGGCATTGTTGTTTACAAACTCCCTACAGATGGCTAC
ACCACTTGAAGCTTTGGCTGCTGAGACATGTGAACCAGAGAGCTCCATGTTTAGCATGCCAATTTTGTTACTTGTAGCTT
TAATTGGAGCCACCGTTGGAGGGTTGCTTGCTCGGCAGAGGAAAGGGGAGTTACAGAGGTTGAATGAACAACTACGACAG
ATTAACGCAGCTCTTAGGAGACAAGCGAAAATTGAGTCATATGCACCAAGCTTGAGTTATGCCCCAGTGGGAGCAAGGAT
CCCAGAGAGTGAAATCATTGTGGACCCAAAGAAACATGAGTTGATTTCCAAGTTGAAAACAGGAAAAACCTTTCTTAGAA
ATCAAGAACCAGAGAAAGCGTATGCTGAGTTCAAGATAGCTCTGGAACTTGCACAGAGTCTAGGAGACCCCACTGAAGAA
AAGAAAGCTGCAAGAGGCTTAGGCGCCTCACTGCAACGCCAAGGGAAGTATAGAGAAGCCATACAGTATCACTCCATGGT
TCTGGCCATCTCAAAGAGGGAGGGCGAAGATTCTGGAACCACTGAAGCATATGGAGCTATTGCAGACTGTTATACTGAGC
TGGGAGATCTCGAGAAAGCTGGAAATTTCTATGATACATACATTGCTCGGTTAGAGACGGACTGA