Details for Capsella Locus Carubv10014219m

Position : scaf_3 ( 5`- 3834424 .. 3836374 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014219m

Protein [Map View]
MANPAGSTGGVNLDKFFEDVESVKEELKELDRLNEALSSSHEQSKTLPNAKAVKDLRSKMDGDVGVALKKAKMIKVKLEA
LDRANAANRSLPGCGPGSSSDRTRTSVLNGLRKKLKDSMDSFNHLRERISSEYRETVQRRYFTVTGENPDEGTLDRLIST
GESERFMQKAIQEQGRGRVLDTINEIQERHDAVKDIEKNLRELHQVFLDMAVLVEHQGAQLDDIESHVGRASSFIRGGTE
QLQTARVYQKNTRKWTCYAIIILIIIIIVVVLLVVKPWNSGNGGGGGGGGGNSGGAQPNSGPPPSPPQARRLLR*

DNA
ATGGCGAACCCAGCGGGATCAACCGGTGGTGTGAACCTGGACAAGTTCTTCGAAGATGTTGAATCTGTGAAAGAGGAGTT
GAAAGAGCTAGATCGGCTCAACGAAGCACTCTCTTCCTCTCACGAGCAGAGCAAGACGCTTCCCAATGCTAAAGCCGTGA
AGGATCTCAGGTCTAAAATGGACGGTGACGTTGGAGTCGCCTTGAAGAAGGCCAAGATGATTAAGGTTAAACTCGAGGCG
TTAGATCGCGCCAATGCTGCTAATCGGAGTCTCCCTGGCTGTGGACCTGGTTCTTCCTCCGATCGAACCAGGACCTCTGT
CCTCAATGGTCTCAGGAAGAAATTGAAGGACTCTATGGATAGTTTCAACCATTTGAGGGAGCGTATCTCGTCCGAGTATA
GAGAAACTGTACAGAGGAGGTACTTCACCGTCACCGGCGAGAATCCGGACGAAGGAACCCTGGATCGACTTATCTCCACT
GGAGAGAGTGAGAGATTCATGCAGAAAGCTATACAAGAACAAGGAAGAGGAAGGGTGTTAGACACCATTAACGAGATCCA
AGAAAGGCATGACGCGGTTAAAGACATTGAGAAGAATCTCAGGGAGCTTCACCAGGTGTTTCTAGACATGGCCGTGCTGG
TAGAGCACCAGGGAGCTCAGCTGGATGACATTGAGAGCCATGTGGGCAGAGCTAGTTCCTTTATCAGAGGCGGAACAGAG
CAGCTACAAACCGCTCGGGTTTACCAGAAGAACACGCGGAAATGGACATGTTATGCCATTATTATTCTCATCATCATCAT
CATTGTTGTGGTTCTTCTTGTTGTTAAACCATGGAACAGCGGAAACGGCGGAGGTGGTGGTGGTGGTGGTGGAAACAGTG
GAGGAGCTCAGCCAAATTCAGGGCCACCACCAAGTCCTCCTCAGGCAAGGCGTCTATTGCGTTGA