Details for Capsella Locus Carubv10014215m

Position : scaf_3 ( 5`- 5492585 .. 5494526 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014215m

Protein [Map View]
MKKSIKIFVFVVSENSYLEVIYQITPIFFSFFHPQQKKKKKISIRSVSMAAAANTAAIFASPSQALSSKRSFLYSPTISP
IQRRFPKRKLDLQVKAVATTLAPQEEIKEYKLPSWAMFEMGTAPVYWKTMNGLPPTAGEKLKLFYNPAASKLTLNEDYGV
AFNGGFNQPIMCGGEPRAMLKKDRGKADSPIYTMQICIPKHAVNLIFSFTNGVDWDGPYRLQFQVPKQWRNKPIEFFDEG
LANELSQDGACERAIFPDSNVVATRCTMIANLTVEGGDRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSEE*

DNA
ATGAAAAAATCTATCAAGATATTTGTATTTGTGGTGTCAGAAAACTCTTATCTTGAAGTCATATATCAAATTACTCCCAT
ATTTTTCTCCTTCTTTCATCCCCAACAAAAAAAAAAAAAAAAAATTTCAATCAGATCAGTTTCCATGGCTGCTGCCGCTA
ATACCGCTGCCATTTTTGCCTCTCCTTCGCAGGCTTTATCCTCTAAACGCAGTTTTTTGTATAGTCCAACGATCAGTCCA
ATACAAAGGAGATTTCCAAAGAGGAAACTTGATTTGCAAGTAAAAGCTGTTGCCACAACTCTTGCTCCACAAGAAGAAAT
CAAAGAATATAAGCTTCCTTCATGGGCAATGTTCGAGATGGGTACTGCTCCAGTGTACTGGAAAACCATGAATGGTCTTC
CTCCAACCGCAGGTGAAAAGTTGAAACTTTTCTATAATCCAGCTGCAAGCAAACTCACTCTTAACGAGGACTATGGGGTT
GCTTTTAACGGAGGATTTAACCAACCAATCATGTGTGGTGGGGAGCCAAGAGCAATGCTAAAGAAAGATCGAGGCAAAGC
CGACTCTCCAATTTACACTATGCAGATTTGCATTCCTAAACATGCTGTGAATTTGATATTCTCGTTCACCAACGGTGTCG
ATTGGGACGGTCCATACAGACTTCAGTTTCAAGTCCCCAAGCAATGGCGAAACAAACCTATCGAGTTCTTCGATGAGGGT
CTAGCCAACGAGTTGAGCCAAGATGGAGCTTGCGAGAGAGCAATATTTCCTGACTCGAACGTTGTTGCCACACGTTGCAC
AATGATCGCCAACTTGACGGTCGAAGGAGGAGATAGATGCAATCTGGATCTGGTTCCTGGGTGCATGGATACAAATTCGG
AACATTTCAACCCATACGCTAATGTTGATGATGGCTCTTGTCCCCTCGAGTTATCCGATTCTGAGGAATAG