Details for Capsella Locus Carubv10014206m

Position : scaf_3 ( 5`- 7625683 .. 7627684 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014206m

Protein [Map View]
MQLQTQSFALTLLPSPNFAKPTERREFISLKRDPSRPISLRCSVSTASDTPLTATHHLSASTHKPFPAEVSRSIMELSSV
GTLSTLTHDGWPLGVGVRFAVDQDGTPVLCLNRTFSPDKRSALHVQLEQCGLRTPQCTIQGSISRPGDDLVLKRLSATWR
KKFGEEVEEDSLYVVAVDRVLQMEDFMEDGIWVASSDYKSASPDPLRDVAEDIVNQINTNNMEDIFRFCNVYVDLDFVVS
ETKMIWMDRLGFDLRVWSPRGIYDVRIPFPMEVTDEKGAKSSFNGMSQLAWEVEKSYCPAEFNKVKLLKQVVGSSHKGGH
*

DNA
ATGCAACTCCAAACCCAATCCTTCGCTCTCACTCTTCTCCCATCTCCTAATTTCGCCAAACCCACCGAGAGACGCGAATT
CATCTCTCTCAAACGAGACCCGTCTCGTCCAATTTCGCTCCGATGCTCCGTTTCCACGGCTTCGGATACTCCGTTGACGG
CGACCCATCATCTCTCCGCTTCCACCCACAAGCCCTTTCCGGCGGAGGTTTCGAGGAGTATCATGGAGCTTTCCTCCGTT
GGAACTCTCTCCACTTTGACCCACGACGGCTGGCCTCTCGGCGTTGGAGTTCGCTTCGCCGTTGACCAAGATGGCACTCC
TGTTCTTTGCCTCAATCGCACTTTCTCTCCTGACAAGAGGTCTGCTCTTCATGTTCAGTTAGAACAATGTGGATTGAGAA
CTCCTCAGTGTACGATACAAGGTAGCATTAGTCGCCCAGGAGACGATCTTGTTCTAAAGCGCCTTAGTGCTACATGGAGG
AAAAAGTTTGGCGAAGAAGTTGAGGAGGACAGTTTATATGTTGTAGCAGTTGACCGTGTACTCCAAATGGAAGACTTCAT
GGAGGACGGGATCTGGGTGGCGTCATCAGATTATAAAAGTGCAAGTCCTGATCCTCTTCGAGATGTTGCAGAAGATATTG
TCAACCAGATCAACACTAACAACATGGAAGACATTTTCCGATTCTGCAACGTATACGTGGATCTAGACTTTGTGGTTTCA
GAAACAAAGATGATTTGGATGGATAGGCTTGGATTTGACCTCCGAGTATGGTCTCCACGAGGTATATATGATGTGAGGAT
TCCGTTTCCAATGGAAGTAACAGATGAAAAGGGAGCAAAATCATCCTTCAATGGAATGTCACAGCTCGCTTGGGAAGTAG
AGAAAAGCTATTGCCCTGCAGAATTTAACAAGGTCAAACTACTTAAGCAAGTAGTAGGATCATCACACAAGGGAGGACAT
TAA