Details for Capsella Locus Carubv10014204m

Position : scaf_3 ( 5`- 1539405 .. 1541349 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014204m

Protein [Map View]
MGIDLESVSEATSGAIGSLLSTTILYPLDTCKSKFQAEVQARGQQKYRYLSDVMWEAISKGQVFSLYQGLGTKNFQSFIS
QFIYFYSYSYFKRVHSERTGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQTSEFGESKGLWKTLTERTWRDAFDG
LGISLLLTSNPAIQYTVFDQLKQHLLKQKNAQTENSSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADDSKE
NETKKPRRRTRKTILGVVYAIWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKITATTWILILAIRRTLFLTKGKLKSP
*

DNA
ATGGGTATCGATTTGGAATCGGTGTCGGAAGCGACCTCCGGAGCCATTGGGTCGCTTCTGAGTACAACAATTTTGTATCC
ACTTGATACATGTAAATCAAAGTTTCAAGCCGAGGTTCAAGCTCGAGGTCAGCAAAAATACAGATATCTTTCAGATGTTA
TGTGGGAGGCGATATCTAAAGGACAAGTCTTTTCGCTGTATCAAGGCCTTGGAACCAAGAATTTTCAGTCTTTTATTTCT
CAATTCATCTACTTTTATAGCTATAGCTATTTCAAGAGGGTTCATAGTGAAAGGACTGGTTCTAAATCAATTGGAACGAA
GGCGAACTTGCTTATTGCTGCTGCTGCTGGGGCTTGTACTTCTGTCTTAATTCAGCCTCTAGATACAGCTTCATCAAGGA
TGCAAACGAGTGAGTTTGGGGAGTCAAAAGGGTTGTGGAAGACCTTAACAGAGCGTACATGGAGAGATGCATTTGATGGC
CTAGGGATCTCCCTTTTATTGACTTCAAATCCTGCAATTCAGTATACGGTGTTCGATCAGCTGAAACAGCACCTTCTTAA
GCAGAAAAACGCACAAACTGAGAACAGTTCTTCTCCGGTAGTGCTCTCTGCCTTTATGGCATTTGTGTTAGGTGCTGTCT
CCAAAAGTGTTGCCACCGTGCTCACATATCCAGCAATCAGGTGCAAGGTGATGATTCAAGCTGCGGATGACTCGAAGGAA
AACGAAACTAAGAAGCCCAGAAGAAGGACAAGGAAAACAATTCTAGGGGTTGTCTATGCCATATGGAGAAAAGAAGGGAT
GTTAGGGTTCTTTAAGGGATTGCAGGCTCAGATCTTAAAGACTGTCCTGAGCTCAGCATTGCTATTGATGATCAAGGAAA
AAATCACTGCAACTACATGGATTCTCATTTTAGCTATCCGTAGAACTCTGTTTCTCACAAAGGGCAAGTTGAAAAGTCCT
TGA