Details for Capsella Locus Carubv10014203m

Position : scaf_3 ( 5`- 6930425 .. 6934791 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014203m

Protein [Map View]
MTTMSEDERNEFVRMRKEYWRRVAECDGFDMEGVIIPRGIAGLSYANCKHRHFRLKASLPKIYAIAGLHRYNMLKGTNFQ
YFDLLKYSKAGYCVRSFFITLAAIDPCSQLQKTFQVRLDEKTYGKLDLTISIARPTDEEKVTTNKRFRVHFHGEAVADAF
YKGALPDWPSADELNNRKRFYLVTESDLLANDWIRLYLELTLCVRHKGTSERDLSKLQILTVAIETKEDVQPPNARLKAK
SAIVYITFKGLAEAEIGDEIGEHVERKAIVRRVLDECSGYLTLRGGFSNGEKPLHTAEQTVTLPSGEDQNLENECKRPRL
D*

DNA
ATGACGACTATGTCGGAAGATGAACGGAATGAGTTTGTCCGTATGCGGAAGGAATACTGGCGTCGAGTGGCCGAATGCGA
TGGTTTCGATATGGAGGGTGTAATAATACCAAGAGGAATCGCTGGACTGTCGTACGCCAACTGTAAACACCGACATTTTA
GGCTTAAGGCTTCTTTACCCAAGATTTATGCTATTGCGGGGCTTCATCGTTACAACATGCTCAAGGGGACAAATTTCCAG
TACTTTGACTTACTTAAATACAGCAAGGCAGGGTACTGTGTGCGGTCTTTCTTCATAACTTTGGCTGCAATAGATCCTTG
CAGCCAATTGCAGAAAACCTTTCAGGTTCGACTTGATGAAAAGACCTATGGAAAACTGGATTTGACGATCTCTATTGCCA
GACCTACCGATGAAGAGAAAGTGACCACGAACAAGCGTTTCAGAGTTCACTTTCATGGTGAAGCAGTGGCCGATGCTTTC
TACAAAGGTGCATTGCCAGATTGGCCATCAGCTGATGAGCTGAATAATCGAAAACGTTTTTACCTGGTGACTGAATCAGA
CTTGCTAGCCAATGACTGGATTCGCTTGTATCTGGAACTTACCCTCTGTGTACGACATAAGGGGACTTCAGAGAGAGATC
TGTCCAAATTGCAGATTCTGACAGTGGCTATAGAAACTAAGGAAGATGTGCAGCCGCCTAATGCGCGACTCAAGGCCAAA
AGTGCCATTGTCTACATCACGTTTAAGGGGTTGGCCGAGGCTGAGATTGGTGATGAGATTGGCGAACATGTTGAACGCAA
AGCTATTGTTAGAAGAGTCCTGGATGAGTGCTCAGGATACTTGACTCTCCGCGGTGGGTTTTCGAATGGAGAAAAGCCTC
TGCATACTGCTGAGCAAACTGTGACTCTACCGAGTGGAGAAGATCAAAATTTGGAGAATGAGTGCAAGCGACCTCGCTTA
GACTAA