Details for Capsella Locus Carubv10014200m

Position : scaf_3 ( 5`- 8531521 .. 8533706 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014200m

Protein [Map View]
MYPSIHDDDDLLAAFCFDQSNGVEDPYGYIQTNEENNIFQGFGSSGVNLQPQQHEQFDSFTQQVCSFRGENDVVVYSSSI
GSSQFDLAASFSGVLQQETHKVCGFGGQNDCSAVPHLQQQETGQVVCGGVVEINSSSSVGAVKEELEHVEEECSRKRRRT
GSCSKPGTKACREKLRREKLNDRFMDLSSVLEPGRTPKTDKLVILDDAIRVVNQLRGEANELKETNQKLLEEIKSLKAEK
NELREEKLVLKADKEKMEQQLKSMTVPSSGFMPSQHPAAFHPNKMAVFPSYGYYPNMSMWPFVNPAGRDSSQDVKNLPPV
A*

DNA
ATGTATCCATCAATACACGACGACGATGATCTCCTCGCTGCGTTTTGTTTCGATCAAAGCAATGGAGTAGAAGATCCTTA
TGGATATATCCAGACGAATGAGGAGAACAACATCTTTCAGGGTTTTGGGTCCTCTGGTGTGAATCTGCAGCCACAGCAAC
ACGAACAATTCGATTCTTTTACTCAGCAAGTCTGTAGCTTTAGAGGGGAGAACGATGTAGTTGTTTATAGTAGCAGCATT
GGATCATCACAGTTTGATTTGGCTGCTTCGTTTAGTGGAGTTTTGCAGCAAGAGACGCATAAAGTCTGTGGCTTTGGAGG
ACAAAACGATTGTTCTGCAGTGCCTCATTTGCAGCAGCAGGAAACAGGACAAGTGGTGTGTGGTGGTGTAGTGGAAATCA
ATTCTTCTTCATCTGTTGGAGCTGTTAAGGAAGAGCTAGAACATGTCGAGGAAGAATGCTCACGAAAGAGGAGACGAACT
GGATCATGTAGCAAGCCAGGAACCAAAGCCTGTCGCGAGAAGCTGAGAAGGGAAAAGTTAAATGACAGGTTCATGGACTT
GAGCTCTGTATTAGAGCCCGGCAGGACTCCCAAGACGGATAAATTAGTTATACTCGATGATGCAATCCGGGTTGTGAATC
AGCTCAGAGGTGAAGCTAATGAACTAAAAGAAACCAACCAGAAGCTTTTGGAAGAGATCAAGAGTCTAAAGGCCGAGAAA
AACGAGCTACGGGAGGAAAAGCTGGTGTTGAAGGCGGATAAGGAGAAGATGGAGCAACAGCTGAAATCTATGACGGTTCC
ATCATCGGGTTTCATGCCCTCCCAGCATCCAGCAGCTTTCCATCCCAATAAAATGGCGGTTTTCCCGAGCTACGGTTACT
ATCCAAACATGTCAATGTGGCCATTCGTCAATCCTGCTGGCCGTGATTCATCTCAAGATGTTAAAAATCTTCCTCCTGTT
GCTTAA