Details for Capsella Locus Carubv10014198m

Position : scaf_3 ( 5`- 4341140 .. 4342860 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014198m

Protein [Map View]
MATFHTVKDAVKLFDAGFSGGKPLNKRQEQGVLVDETNLCLWNREINKLKEKIKNTEKIKIEALLELDEAKKTVEHLCQK
LGTKLNMRNDEKEFDLSTSVRGVTTELGFAKESIHRVAEEEGELCILVESLKLELQKVEKEHSELKESEQRERNQAIEEL
KKEAKDAKTELSLLEGELKIALSEAQEAKAAEAHAREQLNVAVIQSDFRSSAEVKESGAEELTETEALRACRDETLKTLE
MSEREIEDIKAATQDALKKAEMAQEATVVVDVELKRRRKAASRVLAESKMCAKSTKEVVKSKPRSASLFGQVLEESGLFC
NL*

DNA
ATGGCTACTTTTCATACTGTTAAAGATGCGGTTAAGCTCTTTGACGCTGGCTTCTCTGGAGGAAAGCCTCTCAACAAGAG
ACAAGAACAGGGAGTGTTGGTGGATGAGACAAACCTCTGTCTCTGGAACAGAGAGATTAACAAGTTGAAGGAAAAGATAA
AGAATACTGAGAAGATCAAGATTGAGGCTTTGTTAGAGCTTGATGAAGCTAAGAAAACTGTTGAACATCTCTGTCAGAAG
CTGGGAACTAAGCTGAATATGAGAAATGATGAGAAAGAGTTTGATTTGAGTACTAGTGTGAGAGGTGTGACTACAGAGCT
AGGCTTTGCTAAGGAATCGATTCACAGAGTAGCTGAAGAGGAGGGTGAATTGTGTATATTAGTGGAGTCTCTTAAGCTCG
AGCTTCAAAAAGTAGAGAAAGAACATTCAGAGCTTAAAGAGAGTGAGCAAAGAGAAAGGAATCAAGCCATTGAGGAGCTG
AAGAAGGAAGCCAAAGATGCAAAGACAGAACTCTCGCTGTTAGAAGGGGAGCTTAAGATTGCTCTTTCCGAAGCTCAAGA
AGCAAAAGCAGCAGAGGCACATGCCAGAGAACAGTTGAATGTTGCAGTTATACAATCTGATTTCAGATCATCAGCTGAGG
TAAAAGAAAGTGGTGCCGAAGAATTAACTGAGACAGAAGCGTTAAGAGCTTGTAGAGATGAAACACTCAAGACGCTAGAA
ATGAGTGAGAGGGAGATTGAAGATATAAAAGCGGCAACACAAGATGCCTTGAAGAAAGCTGAGATGGCTCAAGAAGCTAC
AGTTGTGGTGGATGTTGAGCTTAAACGACGGCGTAAAGCAGCGAGTAGGGTCTTGGCAGAATCCAAAATGTGTGCCAAAT
CTACAAAGGAAGTGGTCAAGTCGAAACCGAGATCAGCGTCATTGTTTGGTCAAGTGTTAGAAGAATCTGGTCTCTTTTGT
AATTTGTGA