Details for Capsella Locus Carubv10014197m

Position : scaf_3 ( 5`- 2860734 .. 2862860 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014197m

Protein [Map View]
MVKATKAEKKIAYDAKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDSVVLMGKNTMMKRSVRMHSENTGNTSILNL
LPLLQGNVGLIFTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV
ELIKQGDKVGSSEAALLAKLGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAP
HMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKFAVAVAAVSADAGGGAQAAAAPKVEEKKEESDEEDYDGGFGLFD
EE*

DNA
ATGGTGAAAGCAACCAAGGCCGAGAAGAAGATCGCGTACGACGCCAAGCTATGTCAGCTTATCGATGAATACACCCAGAT
CTTGGTCGTTGCGGCCGATAACGTCGGATCAACTCAGCTCCAGAACATCAGAAAGGGTCTTCGTGGAGACTCTGTGGTGC
TTATGGGAAAGAACACTATGATGAAGCGTTCCGTTAGGATGCACTCTGAGAACACCGGAAACACTTCTATCCTGAATCTG
CTTCCTCTCCTTCAGGGAAACGTTGGTTTAATCTTTACCAAAGGTGACCTCAAGGAAGTGAGTGAGGAGGTTGCTAAGTA
CAAGGTTGGTGCTCCTGCTCGTGTGGGTTTGGTTGCCCCAATTGATGTCGTTGTCCAACCTGGCAACACTGGTCTCGACC
CGTCCCAGACATCTTTCTTCCAGGTGCTTAACATCCCAACCAAGATTAACAAGGGTACTGTTGAAATTATCACCCCTGTG
GAGCTCATCAAGCAAGGTGACAAGGTTGGGTCTTCTGAGGCTGCCCTTCTAGCCAAGCTTGGCATCAGGCCGTTCTCATA
TGGTCTTGTTGTCCAATCGGTTTATGACAATGGTTCAGTCTTCAGCCCAGAGGTTCTTGATCTTACAGAAGATCAGCTTG
TGGAGAAGTTTGCTTCTGGTATCTCTATGGTCACTTCCTTGGCCTTAGCTGTATCTTACCCTACCCTTGCTGCTGCACCG
CATATGTTCATCAATGCCTACAAGAATGCCTTGGCTATTGCTGTTGCCACTGAGTACACCTTCCCTCAAGCAGAGAAGGT
TAAGGAGTTCTTGAAGGATCCTAGCAAGTTTGCTGTTGCTGTAGCAGCTGTGTCTGCGGATGCAGGTGGTGGTGCTCAAG
CTGCAGCTGCTCCTAAAGTAGAGGAGAAGAAAGAAGAATCTGATGAAGAAGACTACGACGGTGGTTTTGGTTTGTTCGAT
GAAGAGTAG