Details for Capsella Locus Carubv10014195m

Position : scaf_3 ( 5`- 2030827 .. 2033087 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014195m

Protein [Map View]
MEDKGRSLKNNNMEDEMDLKRGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVRRGNITLE
EQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQSASATASA
ATTTTGSAGTSSCITTSNNHQFMNYDYNNNNNSMGQQFGVMSNNDYITPENSSVAVSPVSDLTEYYSAPNPNPNPEYYSG
QMGNSYYPDQNMVGPQLLPENYFDYSGLLDEDLTAMQEQSNLNWFENINGAASSSDSLWNIGESDEDFWFLQQQQLNNNG
SF*

DNA
ATGGAAGACAAAGGAAGAAGCTTGAAGAACAACAACATGGAAGACGAAATGGACCTAAAGAGAGGTCCCTGGACAGCTGA
AGAAGATTTTAAGCTCATGAATTACATTGCTACTAATGGAGAAGGTCGATGGAACTCTCTTTCTCGTTGCGCTGGACTCC
AACGCACCGGTAAAAGCTGTAGACTGCGGTGGTTGAACTATCTCCGCCCTGACGTCCGCCGTGGAAACATTACACTCGAA
GAACAACTCTTGATCCTCGAACTTCATTCCCGTTGGGGCAATAGATGGTCAAAAATCGCACAATATTTACCGGGAAGAAC
GGACAACGAGATAAAAAACTACTGGAGAACAAGGGTGCAAAAACATGCGAAACAGTTGAAATGTGATGTGAACAGCCAAC
AGTTCAAAGACACGATGAAGTACTTATGGATGCCTCGGCTAGTCGAGAGGATCCAATCCGCCTCGGCCACAGCCTCAGCC
GCCACCACAACCACGGGATCAGCCGGCACGTCATCTTGCATCACAACCTCTAACAATCATCAGTTCATGAATTACGACTA
CAACAACAACAACAACAGCATGGGACAACAGTTTGGTGTCATGAGCAACAACGATTACATCACGCCGGAGAACTCCAGCG
TGGCAGTGTCTCCGGTTTCAGACTTGACGGAGTACTACAGCGCTCCAAACCCGAACCCGAACCCGGAATACTATTCGGGT
CAAATGGGGAATAGTTATTATCCGGATCAGAATATGGTTGGTCCACAGTTATTACCGGAGAATTATTTCGACTACAGTGG
ATTATTGGACGAAGATCTAACGGCTATGCAAGAGCAGAGTAACCTCAACTGGTTTGAAAACATTAATGGTGCTGCTTCCT
CTTCAGACAGTTTATGGAATATCGGCGAAAGTGATGAAGACTTCTGGTTCTTACAGCAACAACAGCTCAACAATAATGGT
AGCTTCTGA