Details for Capsella Locus Carubv10014193m

Position : scaf_3 ( 5`- 6092922 .. 6094803 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014193m

Protein [Map View]
MAAVPRGLISRINQFLSIRSITPSSSESLPHCSFFLLRRFSSDAGLVDGGGSDIIGAPTRIIEAKQGEMSSSSKRTGIIA
VKCGMTALWDKWGARVPVSILWVDDNIVSQVKTVEKEGIFALQIGCGQKKPKHLSKSVVGHFRAQGVPLKRKLREFPVTE
DALLPVGTSLGVRHFVPGQYVDVTGITRGKGFQGCMKRWNFKGMPGSHGASLSHRSAGSTGQRDAPGKVFKGKKMAGRMG
AEQRTVKNVWVYKIDPARNLIWVRGQVPGAEGNFVFIRDAWYKKPDISKLPFPTYLAPEDEDPSELEPLVADLGEVDPFM
LAE*

DNA
ATGGCGGCCGTACCGAGAGGCCTCATTTCTCGCATCAATCAGTTTCTATCGATCCGGTCTATAACTCCTTCATCCTCTGA
ATCTCTTCCTCATTGTAGCTTCTTTCTCCTCCGACGATTCAGCTCCGATGCTGGCTTGGTCGACGGCGGTGGATCTGATA
TTATCGGGGCTCCGACCCGAATCATCGAGGCGAAACAAGGCGAGATGTCTAGTAGCTCTAAAAGGACTGGGATCATCGCC
GTTAAGTGTGGGATGACTGCGCTCTGGGACAAATGGGGAGCTAGGGTTCCGGTTTCTATTCTCTGGGTTGATGATAACAT
TGTCTCTCAGGTCAAAACTGTTGAGAAAGAAGGGATTTTTGCGTTACAGATCGGATGTGGGCAAAAGAAACCTAAGCATT
TGTCGAAGTCTGTGGTGGGGCATTTCAGAGCACAAGGTGTGCCGTTAAAGAGAAAGTTGCGGGAATTTCCTGTGACAGAA
GACGCTCTTCTTCCTGTTGGTACTTCACTCGGAGTCCGCCATTTTGTTCCGGGACAGTACGTTGATGTCACTGGGATCAC
TCGAGGGAAAGGTTTTCAGGGATGCATGAAAAGATGGAATTTCAAAGGAATGCCTGGATCACATGGTGCTTCATTGTCCC
ATCGAAGCGCTGGTTCCACAGGGCAAAGAGATGCCCCTGGAAAGGTGTTCAAGGGGAAAAAGATGGCTGGAAGAATGGGT
GCAGAACAGAGGACAGTAAAGAACGTTTGGGTTTACAAGATCGATCCTGCACGGAACCTCATCTGGGTGAGAGGACAAGT
TCCTGGCGCAGAAGGAAATTTTGTGTTCATAAGAGATGCATGGTACAAGAAACCAGATATCTCGAAGCTTCCGTTTCCAA
CTTATTTAGCTCCAGAAGACGAAGATCCATCAGAATTAGAACCGTTGGTTGCTGATCTTGGAGAAGTTGACCCATTTATG
TTGGCAGAGTGA