Details for Capsella Locus Carubv10014192m

Position : scaf_3 ( 5`- 7052099 .. 7055451 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014192m

Protein [Map View]
MSLVCSSACVAPLPQTKRLRPNFLKLTTCTLNLSASTGDIRKHISYLFAEPHKLCRLAKSRILVSQESFTETSTIDMDWE
DQEEIEDIGSPWEGSVMYRRNASVTHVEYCTTLERLGLGRLSTEVSKKRASAMGLRVTKDVKDYPDGTPVQIAVDVIRKK
KKLRLDGIVKTVITLGCNRCGESTGESIFSNFSLLLTEDPVEEPDVIDLGFTFGSDKANSFSGLSDDKEETEDDDDSWID
WEDKLHFPPEAKEIDISKHIRDLVHLEITITAICDPGCKGMCLKCGANLNKRKCECGREEKDKGYGPLGNLREKMQQKEG
LRN*

DNA
ATGTCTCTGGTTTGCTCTTCAGCATGTGTAGCTCCCTTGCCACAGACCAAACGGTTACGTCCAAATTTTCTGAAACTCAC
AACATGTACCTTAAATCTAAGTGCTTCCACTGGCGATATTAGGAAGCATATCAGTTACTTGTTCGCAGAACCGCATAAAC
TTTGTAGGCTAGCAAAGAGTCGGATATTAGTTAGTCAGGAGTCTTTTACAGAGACCAGCACAATAGATATGGATTGGGAA
GATCAGGAGGAGATTGAGGATATCGGGTCACCTTGGGAAGGTTCGGTTATGTATAGGAGAAATGCTTCAGTCACACATGT
AGAATACTGCACTACCTTAGAGAGGCTTGGGTTGGGAAGATTGTCAACAGAGGTCTCCAAGAAGAGAGCTTCCGCAATGG
GACTAAGAGTGACAAAAGATGTAAAGGATTATCCAGATGGCACACCAGTTCAAATTGCGGTTGATGTCATAAGGAAGAAG
AAGAAGCTGAGACTCGATGGGATTGTCAAGACTGTTATCACACTTGGCTGCAACAGATGTGGTGAGTCAACAGGAGAGAG
CATATTCTCCAACTTCTCACTATTACTAACCGAAGATCCAGTTGAAGAACCCGATGTCATTGATCTAGGATTCACATTTG
GTAGTGACAAAGCCAATTCCTTTTCCGGATTGTCGGATGATAAAGAAGAAACTGAGGATGATGATGATTCATGGATAGAT
TGGGAGGATAAACTTCATTTTCCCCCTGAGGCGAAAGAAATAGATATCTCAAAGCATATAAGAGACTTGGTCCACTTAGA
GATCACCATCACTGCGATATGCGATCCTGGGTGTAAAGGAATGTGCTTGAAGTGTGGTGCGAATCTGAATAAGAGGAAAT
GTGAGTGTGGCAGAGAAGAGAAAGATAAAGGATATGGTCCTCTCGGAAACCTGAGAGAGAAAATGCAACAAAAAGAGGGT
CTGAGGAACTAA