Details for Capsella Locus Carubv10014181m

Position : scaf_3 ( 5`- 8718476 .. 8720662 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014181m

Protein [Map View]
MMEIRTPKTGKAKRVLEKRAPKLVETGKKTLILHGTKTSATVSSVLMELYRLKKGGAIKYSRRNENIRPFESGGETSLEF
FSQKTDCSLFVYGSHTKKRPDNLVLGRMYDHQVYDLIEVGIENYKSLLSFSYDKKFAPHEGSKPFICFTGEGFENVPELK
HLKEVLTDLFRGEVVDNLNLTGLDRAYICSAISPTKVFLTHCALKLKRSGTIVPKMELVEVGPSMDLVIRRNRLPNESLK
KEAMRTSKDNPKKKVKNVDQDAVRGKIGKIYMPDQKLGEMQLPDKSKGVKRERKEGKLKKHKEESASKKKKNSSDSEKIP
TDAE*

DNA
ATGATGGAAATACGAACTCCAAAGACCGGCAAAGCCAAGCGTGTACTCGAAAAAAGAGCTCCTAAGTTGGTTGAAACTGG
GAAGAAGACGTTGATACTTCATGGAACAAAGACGAGCGCTACTGTTAGCTCTGTATTGATGGAACTGTACCGTTTGAAGA
AGGGAGGAGCTATCAAATACTCGAGGAGGAATGAGAATATTAGGCCTTTTGAGAGTGGAGGTGAAACCTCTTTAGAGTTC
TTCTCTCAGAAAACAGATTGTAGCCTTTTTGTGTACGGGTCTCACACAAAGAAACGACCTGACAATCTTGTACTTGGGAG
AATGTACGATCACCAGGTCTATGATCTTATAGAAGTTGGGATTGAGAACTATAAATCTTTGCTGTCGTTTTCCTATGACA
AGAAATTTGCACCTCATGAAGGATCAAAGCCTTTCATTTGCTTTACTGGTGAAGGTTTTGAGAATGTACCAGAGCTTAAG
CATCTTAAAGAAGTCCTGACTGATCTATTTCGTGGCGAGGTTGTGGATAATCTAAATCTTACTGGATTAGACCGTGCTTA
CATATGCTCAGCTATATCCCCAACTAAGGTTTTCCTTACTCATTGCGCATTGAAGCTTAAAAGGTCAGGGACCATTGTTC
CTAAAATGGAGCTTGTTGAAGTTGGTCCATCGATGGACTTGGTTATCAGACGTAATCGTCTTCCTAACGAAAGCTTAAAG
AAAGAAGCAATGAGAACATCCAAGGATAATCCTAAGAAGAAGGTGAAAAACGTTGATCAAGATGCAGTACGCGGAAAGAT
TGGGAAGATTTATATGCCTGATCAGAAGCTCGGCGAGATGCAATTGCCCGATAAATCCAAGGGAGTGAAGAGAGAGCGGA
AAGAGGGTAAGCTGAAGAAGCACAAGGAGGAGTCTGCTTCCAAAAAGAAGAAAAATTCTTCCGACTCTGAGAAAATTCCT
ACCGATGCTGAGTGA