Details for Capsella Locus Carubv10014177m

Position : scaf_3 ( 5`- 5602681 .. 5604436 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014177m

Protein [Map View]
MGGWAIAVHGGAGVDPNLPAERQEDAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPLFNSGRGSALTEKGTVEM
EASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEDFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSI
LFDYRIPPMGCAGAAATDSPIQMNGLPISIYAPETVGCVVVDGEGRCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASELC
GVSCTGEGEAIIRATLARDVSAVMEYKGLNLQEAVDYVIKHRLDEGFAGLIAVSNKGEVVCGFNSNGMFRGCATEDGFME
VAIWE*

DNA
ATGGGTGGGTGGGCAATCGCAGTACACGGTGGTGCCGGTGTCGATCCTAATCTTCCGGCTGAGAGACAAGAAGATGCCAA
ACAGCTTTTGACCCGATGTCTTAACCTCGGCATAGTAGCTTTGCGTTCTAATGTCTCTGCCATTGATGTCGTTGAGCTCG
TCATTAGAGAACTGGAGACGGATCCTCTGTTTAACTCAGGCCGTGGATCTGCTTTGACAGAGAAAGGAACGGTGGAGATG
GAAGCTAGCATTATGGACGGTACGAAGAGACGATGCGGTGCCGTTTCGGGGATCACCACCGTGAAGAATCCTATATCTCT
TGCTCGTCTCGTCATGGACAAATCTCCCCACTCTTACCTTGCTTTCTCAGGTGCTGAGGATTTCGCTCGTAAACAGGGAG
TTGAAATTGTGGACAACGACTACTTCGTCACGGACGACAACGTAGGAATGCTCAAGTTGGCCAAGGAAGCTAACTCCATC
TTGTTTGATTACCGTATTCCGCCCATGGGATGCGCCGGTGCAGCTGCAACCGACAGTCCTATCCAAATGAACGGTCTTCC
AATCAGCATTTACGCCCCGGAGACAGTCGGGTGCGTCGTGGTAGACGGGGAAGGACGGTGTGCGGCTGGGACATCAACCG
GGGGTCTGATGAACAAGATGATGGGGAGGATTGGTGACTCGCCGCTTATAGGAGCAGGGACGTACGCGTCGGAGCTCTGT
GGTGTGTCATGTACAGGAGAAGGAGAAGCCATCATAAGAGCTACGCTAGCTCGTGATGTGTCGGCTGTTATGGAGTACAA
AGGACTTAACCTCCAAGAAGCTGTTGATTACGTCATCAAGCATCGATTAGACGAAGGGTTTGCTGGACTCATCGCTGTGT
CAAATAAAGGAGAGGTGGTTTGTGGTTTTAATTCCAATGGGATGTTCAGGGGATGTGCTACAGAGGATGGATTCATGGAG
GTTGCTATTTGGGAGTGA