Details for Capsella Locus Carubv10014175m

Position : scaf_3 ( 5`- 1862570 .. 1864955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014175m

Protein [Map View]
MAAMDSLFLLFLIPLIPLSLLAILALIVRPRPIKIPIKSRHVFVTGGSSGIGLALAQRAASEGARVSILARSAEKLEEAK
KLIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLVVNQGVFVAKELVNHSPEDVKFTIDVNLVGSFNVIKAALPAMK
ARKDRGPASISLVSSQAGQVGIYGYAAYSATKFGLQGLAQALQQEVIADDVHVTLIFPPDTDTPGFEEEQKSRPEVTAII
AASSGSMKTEEVARKAMEGIKAGKFTVSCNFEGFLLSLATTGMSPQRSCWLAFLEVITAGPIRLVALFFQWDWYKAIEKW
SKTKTK*

DNA
ATGGCGGCGATGGATTCTCTCTTCCTTCTCTTCCTCATTCCTCTCATTCCACTCTCGCTTCTCGCTATCTTAGCTCTAAT
CGTACGTCCTCGCCCCATTAAGATCCCTATCAAGTCCCGTCACGTCTTCGTCACCGGTGGATCTAGTGGCATTGGTCTTG
CTCTCGCCCAGCGCGCTGCTTCAGAGGGCGCTCGCGTCTCAATCCTCGCCAGATCCGCCGAGAAGCTCGAGGAGGCTAAG
AAATTGATCCAGCTCGCTACTGGAGTTGAAGTCGCCACGTTCTCTGCCGACGTTCGCGATTACGACGCTGTGTCGAAGGC
GATTGACGAATCGGGGCCGATTGATGTGTTGGTTGTAAATCAAGGTGTGTTTGTCGCGAAGGAGCTGGTGAATCATAGTC
CAGAGGATGTCAAGTTCACGATTGACGTGAATCTTGTTGGGAGCTTCAATGTGATTAAGGCCGCTTTGCCTGCAATGAAA
GCAAGGAAAGATCGTGGACCTGCCTCTATCAGTCTCGTCTCTTCTCAAGCTGGCCAGGTGGGTATCTATGGTTATGCTGC
ATATTCAGCAACCAAGTTTGGTCTACAGGGTTTAGCGCAAGCACTGCAACAAGAAGTTATTGCTGATGACGTTCATGTCA
CTCTTATATTTCCTCCTGATACTGATACACCAGGATTTGAAGAAGAACAGAAGAGCAGACCTGAAGTCACTGCCATAATA
GCTGCATCCTCTGGTTCAATGAAAACAGAAGAAGTAGCCAGAAAAGCTATGGAAGGCATAAAAGCAGGAAAGTTCACTGT
CTCATGCAACTTTGAGGGATTCTTATTGTCTCTTGCGACAACCGGCATGTCCCCTCAAAGATCATGTTGGCTAGCTTTTC
TTGAAGTTATAACCGCCGGGCCAATAAGATTAGTCGCTCTCTTCTTTCAATGGGATTGGTATAAAGCCATTGAAAAATGG
AGCAAAACCAAAACCAAATAA