Details for Capsella Locus Carubv10014172m

Position : scaf_3 ( 5`- 2628829 .. 2631680 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014172m

Protein [Map View]
MSSDRILCKFFVHGSCLKGDNCGFSHDSKDPPNNVCTFYQKGMCFYGSRCRYDHVRASSDLPTPPLTSDSESLDRSLSTA
PSMSFQRQGYDGDGNNHGDKSSSVYCVHPREYPLCSFAAAGDCPRGNQCPHMHGDLCATCGKKCLHPFRPEEREEHTKEC
EKKQKHIEALKQSQDIECSVCLDRILSKATPGERKFGLLTECDHPFCIQCIRNWRSSAPVSGMDVNSTLRACPICRKLSY
FVVPSVVWYSTPEEKKEIIDIYKAKLRSIDCKHFNFGNGSCPFGASCFYKHAYPDGHLEEVVLRHLGSQEGDSIRLSELL
GGLQIF*

DNA
ATGTCCTCCGACAGGATACTGTGCAAGTTCTTTGTCCATGGCTCATGCTTGAAAGGGGATAATTGTGGATTTTCCCATGA
CTCTAAGGATCCGCCTAATAATGTTTGCACATTCTACCAAAAAGGAATGTGTTTTTACGGAAGTAGATGTAGATATGATC
ATGTCAGAGCTTCTTCCGATCTTCCTACACCACCTCTTACCTCTGATTCTGAGTCTCTGGATCGCTCTTTATCCACCGCT
CCCTCTATGAGTTTTCAACGCCAAGGCTATGATGGGGACGGTAATAACCACGGTGACAAATCCTCTAGCGTCTATTGTGT
CCATCCAAGAGAATACCCACTCTGCTCATTTGCTGCCGCTGGTGACTGCCCGCGAGGTAACCAGTGCCCTCATATGCATG
GAGACCTCTGCGCTACTTGTGGCAAGAAGTGTTTGCATCCTTTTAGACCCGAAGAACGAGAAGAGCACACTAAAGAATGC
GAGAAGAAGCAAAAGCACATCGAGGCTTTGAAACAAAGTCAAGATATCGAGTGTAGTGTGTGCTTGGATCGTATCTTGTC
AAAGGCCACTCCAGGGGAAAGGAAGTTTGGGCTGTTGACTGAATGTGATCACCCGTTTTGTATACAGTGCATTCGTAATT
GGCGTAGCAGTGCTCCTGTTTCAGGAATGGATGTCAACAGTACGTTGAGAGCCTGTCCTATATGTCGCAAACTCTCTTAT
TTTGTTGTCCCCAGTGTTGTCTGGTACTCTACTCCTGAAGAGAAAAAGGAAATTATCGACATATACAAGGCAAAACTGAG
ATCAATCGACTGTAAGCATTTTAACTTTGGAAACGGAAGCTGCCCATTTGGAGCAAGTTGTTTCTATAAGCATGCATATC
CTGATGGTCACTTGGAGGAAGTTGTTTTAAGGCATCTTGGTTCTCAAGAAGGAGACAGTATCAGGCTATCAGAGTTACTT
GGTGGCCTGCAGATTTTCTAA