Details for Capsella Locus Carubv10014171m

Position : scaf_3 ( 5`- 3960838 .. 3965049 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014171m

Protein [Map View]
METQIHQLEQEAYTAVLRAFKAQSDAISWEKESLITELRKELRVSDDEHRELLSRVNKDDTIQRIRDWRQGGGSQNTRHA
TIQPFDVLPSPTFSAARKKQKTFQSYHPSIGVTGNRSFNNRVVPSGISGNESAEALIGRKVWTKWPEDNHFYEAIITQYN
ADDGRHALVYDIHAANETWEWVDLKEIPPEDIRWDGEDSGVALNIGHGSGSFRGNRRSQIHGGRGRGPRIHQPRRELVPP
PTQQNGGGGRRTSSDDIELFNTDSLVKEVERVFDSAHPDPLELDKAKKMLKEHEQALIAAIARLADTSDGELDGDPPYSH
DHPMPQG*

DNA
ATGGAGACACAAATTCATCAACTTGAGCAGGAAGCATATACCGCTGTCTTACGGGCTTTTAAAGCGCAGTCTGATGCAAT
TTCTTGGGAAAAAGAAAGCTTGATAACTGAATTACGTAAGGAATTGAGAGTATCTGATGACGAACATCGAGAGCTTCTGA
GTAGGGTCAATAAGGATGATACTATCCAAAGAATAAGAGATTGGAGACAAGGAGGCGGAAGCCAAAATACTAGACATGCA
ACTATTCAGCCTTTTGATGTTCTTCCTAGTCCCACTTTCTCAGCTGCCCGAAAGAAACAGAAAACATTCCAATCTTATCA
TCCATCAATTGGTGTGACTGGAAATAGGTCATTCAATAATCGTGTGGTACCCAGTGGCATATCAGGAAATGAATCTGCTG
AAGCTTTGATCGGAAGAAAAGTGTGGACTAAATGGCCTGAAGATAACCACTTCTATGAAGCAATTATAACCCAGTACAAT
GCAGATGATGGTCGGCATGCTTTGGTGTATGATATACACGCAGCTAATGAAACGTGGGAATGGGTTGATCTCAAGGAGAT
ACCACCCGAAGATATAAGGTGGGATGGGGAGGATAGTGGGGTAGCTTTAAACATTGGACATGGAAGTGGATCATTCCGTG
GCAACCGAAGAAGCCAAATCCATGGTGGTAGAGGGAGAGGACCCAGAATTCATCAACCAAGAAGAGAACTTGTACCACCA
CCAACACAACAGAATGGTGGTGGTGGTCGTAGAACTTCCTCTGATGATATTGAATTGTTCAACACAGACTCGCTTGTGAA
GGAGGTGGAGAGAGTTTTCGATTCTGCGCACCCTGATCCGCTCGAGCTCGATAAGGCCAAGAAAATGCTAAAGGAACATG
AACAGGCACTCATTGCTGCCATAGCAAGGCTTGCTGATACTTCTGATGGCGAACTCGATGGAGATCCACCATATTCGCAT
GATCATCCAATGCCACAGGGATGA