Details for Capsella Locus Carubv10014167m

Position : scaf_3 ( 5`- 1711082 .. 1714583 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014167m

Protein [Map View]
MATRNRTLLFRKYRNSLRSVRAPIGSSIVTTENSSLTGAKSGLGPVIEMASTSLLNPNRSYAPVSTEDPGNSRGTITVGL
PPDWVDVSEDISVNIQRARTKMAELGKAHAKALMPSFGDDKEDQHQIESLTQEITFLLKKSEKQLQRLSAAGPSEDSNVR
KNVQRSLATDLQNLSMELRKKQSTYLKRLRLQKEDGTDLEMNMNGSRYKAEDDDFDDMVFSEHQMSKIKKSEEISLEREK
EIQQVVESVNELAQIMKDLSTLVIDQGTIVDRIDYNIQNVASTVDDGLKQLQKAERTQRQGGMVMCASVLVILCFIMLVL
LILKEILL*

DNA
ATGGCGACTAGGAACCGTACGTTGTTGTTCAGGAAGTACAGAAACTCTCTGAGGAGCGTTCGTGCTCCGATTGGGTCGTC
GATAGTGACGACGGAGAACAGTTCGTTGACGGGAGCTAAATCCGGCTTAGGTCCAGTGATCGAGATGGCGAGCACATCTC
TATTGAATCCGAATCGGTCTTATGCCCCAGTCAGTACTGAGGATCCTGGGAATTCGAGAGGTACGATAACAGTGGGATTA
CCACCAGATTGGGTTGATGTATCTGAAGATATTTCAGTTAACATTCAGCGTGCAAGAACCAAAATGGCTGAACTGGGAAA
AGCTCATGCGAAAGCTTTGATGCCATCGTTTGGGGATGATAAAGAAGATCAACATCAAATCGAGTCTTTGACACAAGAGA
TAACTTTCTTATTGAAGAAATCTGAAAAACAACTTCAGAGGCTTTCTGCAGCAGGGCCATCTGAAGATTCAAATGTCAGG
AAAAACGTCCAGCGATCACTTGCTACTGATCTCCAAAACCTTTCTATGGAGCTTCGCAAGAAACAGTCTACATACTTGAA
ACGCTTGAGACTACAAAAAGAGGACGGAACGGATTTAGAAATGAACATGAATGGAAGCAGATATAAAGCAGAAGATGATG
ACTTCGATGATATGGTATTTAGTGAGCATCAAATGAGCAAGATAAAAAAGAGCGAGGAAATATCGCTAGAGAGGGAGAAA
GAGATTCAACAGGTTGTTGAATCCGTAAATGAACTTGCTCAGATCATGAAGGATCTTTCCACGCTTGTGATAGACCAGGG
TACCATAGTTGATCGGATTGACTACAATATCCAGAACGTTGCTAGTACCGTTGACGATGGTCTCAAACAGCTGCAAAAGG
CGGAACGTACACAGAGACAAGGAGGTATGGTGATGTGTGCGTCTGTTCTTGTCATCCTCTGTTTCATCATGCTAGTACTT
TTAATCCTTAAGGAAATTCTCTTGTGA