Details for Capsella Locus Carubv10014166m

Position : scaf_3 ( 5`- 2714794 .. 2716455 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014166m

Protein [Map View]
MTSHFPSLCSSRPPLAMDDLSLEKIEISGATLASLIQRASSSPSDVDGLIFGQIHRIVSSNLSDDPPADSLASSSSSDQI
VATVTSFVCSGKTVSFYDPLGRVDSRRIDSLRVDSPDRLIGWFSARRKTANRPSMRELAVASSLSSQFHLPVEDLKNPKL
TNMASCVFFLLTTPSSDQCIHTHEYRGYQFRSSKQRLEPRSVGIVNIGPAFRGHYGSFRPKSGFPPLICELDSSAMIVDR
DEGSLGAKKQAVKDQKEIDALAEGLQVGDLKRLVGAEAANNTGGIEDMYEKMLAKVQSLASDVEKSSDRVFQQEKHNRKL
RNRIARMGR*

DNA
ATGACGTCACATTTTCCCTCTTTGTGTTCATCTCGTCCGCCACTCGCCATGGACGATCTCTCACTAGAGAAAATCGAGAT
TTCGGGTGCAACATTGGCGTCCCTGATTCAACGAGCTTCCTCCTCTCCAAGTGACGTCGATGGCTTGATCTTCGGCCAAA
TCCACCGCATCGTCTCCTCTAATCTATCCGACGATCCTCCGGCGGATTCGTTGGCCTCGAGTTCCTCATCTGATCAAATT
GTCGCCACCGTTACGAGCTTTGTCTGCTCCGGTAAGACTGTATCATTCTATGATCCGCTTGGCCGTGTTGACTCGCGTCG
AATCGATTCCCTCCGAGTCGATTCGCCGGACCGCCTGATTGGCTGGTTCTCCGCCCGCCGGAAAACCGCGAACCGTCCCT
CAATGAGAGAGTTAGCCGTCGCTTCATCTCTGTCATCTCAATTTCACTTACCGGTCGAGGATTTGAAAAACCCTAAATTG
ACGAACATGGCTTCATGTGTGTTCTTTCTTCTCACTACGCCATCGAGTGATCAGTGCATCCACACGCACGAGTACCGAGG
GTACCAGTTCCGGTCCTCCAAACAACGACTGGAGCCGAGATCCGTTGGTATAGTCAACATCGGACCGGCGTTTCGGGGCC
ATTACGGTTCGTTTAGACCGAAATCGGGATTTCCACCGTTGATCTGCGAGTTGGATAGCTCAGCCATGATCGTGGATCGC
GATGAGGGTTCATTGGGTGCGAAGAAACAAGCAGTGAAGGATCAGAAGGAGATCGATGCGTTGGCAGAGGGTTTACAAGT
TGGAGACTTGAAACGTTTGGTTGGAGCCGAAGCTGCAAATAACACAGGCGGGATTGAAGATATGTATGAGAAAATGTTGG
CCAAGGTCCAAAGCTTGGCTTCGGATGTAGAGAAGAGCTCGGATAGGGTATTTCAACAGGAGAAGCATAATCGGAAGCTG
CGAAACCGGATTGCCAGAATGGGGCGGTGA