Details for Capsella Locus Carubv10014165m

Position : scaf_3 ( 5`- 13407418 .. 13409250 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014165m

Protein [Map View]
MATNACDVNQLGSDSLLPPRKRLLAGFKKQNSQMGNESPSPPFASSSSITTSNGSSVSTDVQTHLDHLLTSQLNDQSRSP
EELAQASKAAAALAVKVAKAARATANEKAMIASKAVAAAKSALELLTVSCKEKSPRKNKQKKHVPVQALYPKGGLADEDL
ARRLNRAINSSPRVLTDCSGHRNKKQKSVVTYEKSTVTSTMYDGNDVAGVVDSDSSIDEEVERTTRVNGKLLLCDNTMKE
KTWEESSSLGKRRGRVKLKKLPLSMCTSKDQENGITSAGKNISGISKPLAEAEGSNGGGVPAEVIAGPSWKCQDLKSQES
VKEKKVVRS*

DNA
ATGGCTACAAATGCTTGCGATGTGAATCAGCTCGGATCCGATTCGCTTTTACCGCCAAGGAAGCGTTTACTCGCTGGATT
CAAGAAACAGAACTCTCAAATGGGCAACGAATCACCGAGCCCTCCGTTTGCTTCTTCGTCGTCTATTACTACTTCAAATG
GCTCCTCTGTTTCAACAGATGTGCAGACTCATCTCGACCATCTATTGACTTCCCAACTCAATGATCAGTCTAGGTCACCC
GAAGAGCTAGCTCAGGCGTCCAAGGCAGCCGCGGCTTTAGCGGTTAAGGTTGCAAAGGCGGCGAGAGCTACTGCTAATGA
GAAAGCCATGATTGCTTCAAAGGCAGTGGCTGCAGCCAAGAGTGCTTTGGAATTGTTAACTGTTTCCTGTAAAGAGAAGT
CTCCAAGGAAGAACAAGCAGAAGAAACATGTCCCAGTTCAGGCTTTGTATCCCAAAGGAGGACTTGCGGATGAGGATTTG
GCGCGTAGGTTGAATCGGGCTATTAACAGTTCTCCTAGAGTCTTGACTGATTGTTCTGGTCACAGAAACAAGAAGCAAAA
GAGTGTTGTTACCTATGAGAAGAGTACCGTAACTAGTACTATGTACGATGGGAATGACGTTGCTGGTGTTGTGGATTCAG
ACAGCTCGATTGACGAGGAAGTAGAGAGAACGACTAGAGTAAACGGGAAGCTGCTCTTATGCGATAACACGATGAAGGAG
AAAACATGGGAAGAAAGTAGCTCATTGGGGAAAAGAAGAGGAAGAGTGAAGCTAAAGAAGCTGCCTTTGAGCATGTGTAC
ATCTAAAGATCAAGAAAACGGTATCACATCAGCCGGAAAAAACATAAGCGGCATAAGTAAGCCGCTGGCTGAGGCGGAAG
GTTCCAATGGTGGTGGTGTGCCTGCTGAGGTCATAGCAGGACCATCATGGAAGTGTCAGGACCTTAAGTCACAGGAAAGT
GTGAAGGAGAAGAAAGTTGTACGTTCATAG