Details for Capsella Locus Carubv10014162m

Position : scaf_3 ( 5`- 7582118 .. 7584439 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014162m

Protein [Map View]
MEALFTSTHIPNLQTRPLLKSSLPTSSQSSSCWLCSSLPKKQFSKLRISNGSSHGLRVQALLRNETPSEGEDNMAESSGF
DFFSGGVFSLSQENLGSNLIGESCVIDVDALTHHQGGGGNRAGLFRTPISGGVQNATSANALPRPALAVRNLLEQARFAH
LCTVMSKMHHRREGYPFGSLVDFAPDRMGHPIFLFSPLAIHTRNLLAEPRCSLVVQMPGWSGLSKARVTLFGDVYPLSED
EQNISDIYFIGGFGTVAWVDVKEYEALQPDKIAVDGGEQTLKELNAIFSKPLRELLSTESEVDDAALISIDSKGIDVRVR
QGAQVNNIA*

DNA
ATGGAAGCTCTCTTTACTTCAACACACATCCCCAATTTACAGACGAGGCCTCTCCTCAAATCTTCGCTGCCCACTTCTTC
CCAGTCTTCTTCGTGCTGGTTGTGTAGTTCGCTACCCAAAAAGCAATTCTCGAAGCTGAGAATCAGTAATGGATCAAGTC
ACGGGCTTCGTGTACAAGCTCTCTTACGTAACGAGACACCAAGTGAAGGCGAAGACAATATGGCTGAGAGTAGTGGGTTT
GATTTTTTCTCTGGGGGTGTTTTCTCTTTATCACAGGAAAATCTCGGGAGTAATCTCATTGGTGAAAGTTGTGTAATCGA
TGTGGATGCTCTTACACATCACCAGGGTGGTGGAGGAAATCGAGCTGGGCTTTTTAGAACTCCAATATCTGGTGGAGTTC
AAAATGCAACATCAGCTAATGCGTTACCTCGCCCTGCTTTAGCCGTACGGAACTTGTTGGAACAGGCTAGGTTTGCTCAT
CTATGCACAGTGATGTCCAAAATGCACCACCGCAGGGAAGGGTACCCATTTGGCTCATTGGTAGATTTTGCGCCTGATCG
GATGGGGCATCCAATATTTCTATTTTCACCGCTGGCCATCCATACACGAAACTTGTTGGCTGAACCTAGATGCAGTCTCG
TTGTCCAGATGCCCGGATGGAGTGGCTTATCGAAGGCAAGAGTGACATTATTTGGTGATGTTTACCCATTGTCAGAAGAT
GAGCAGAACATAAGTGATATATATTTCATTGGAGGCTTTGGCACTGTGGCTTGGGTTGATGTCAAAGAGTATGAAGCTTT
ACAGCCAGATAAAATAGCTGTTGATGGTGGTGAGCAGACCCTCAAGGAACTAAATGCCATCTTCTCGAAACCGCTTAGAG
AGCTACTATCTACTGAATCAGAGGTAGACGATGCTGCTCTCATTTCGATAGATAGCAAAGGGATAGATGTAAGAGTTCGT
CAAGGTGCCCAGGTAAATAACATTGCATAA