Details for Capsella Locus Carubv10014160m

Position : scaf_3 ( 5`- 2854985 .. 2857523 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014160m

Protein [Map View]
MALSMEFGFSIGSCFKAASTPVLISAIPKKTNFMLTRRSKRFLFKVSAVSYKEFAESALEETRKRIVLEPSPLQKRYSSM
TGLDGKTELQMLAFKSSKIRLLRSMAIENETMQVFDFAGFMEPEYDVPIFCANFFTSANTNIVVLDLNPLHQLTDQTDYQ
GKYYNNIMSIYHKYAETFPWGGKLTGESLKFFSPLVMWTRFSSSQEKHEALFSAFVEYYQAWLEMTIQVREEMEPSQVRA
NREAQHKYLTWRAQKDPGHGLLKRLVGEVKAKELLRDFLFSGVDELGTKTFIDYFPEYQTEDGTVSDKRSIIGKSYETRP
WDLTGQFIG*

DNA
ATGGCTTTGTCAATGGAGTTTGGATTTTCAATTGGGTCTTGCTTCAAGGCAGCAAGCACACCTGTCCTAATCTCGGCAAT
CCCTAAGAAGACCAATTTCATGTTAACTAGGAGAAGTAAAAGATTCTTATTTAAAGTCTCTGCTGTGTCGTATAAGGAAT
TTGCAGAGTCTGCTCTGGAAGAAACCAGGAAAAGGATCGTTCTTGAACCTTCACCTCTCCAGAAAAGGTATAGCAGCATG
ACAGGACTGGATGGGAAAACTGAACTTCAAATGCTTGCTTTCAAATCTTCAAAGATTAGACTCTTACGGAGCATGGCCAT
CGAGAATGAGACAATGCAGGTCTTTGACTTTGCGGGTTTCATGGAGCCTGAGTATGATGTGCCCATATTCTGTGCTAACT
TCTTCACATCTGCCAACACGAACATAGTGGTGTTGGACCTAAATCCTTTGCATCAGTTGACTGACCAGACGGATTACCAA
GGCAAGTATTATAACAACATAATGTCCATATATCACAAATATGCTGAGACTTTTCCATGGGGAGGAAAACTGACTGGTGA
ATCCCTAAAGTTTTTCTCGCCTTTGGTGATGTGGACCAGGTTTTCGTCTAGCCAAGAAAAACATGAGGCTTTATTCTCTG
CGTTCGTTGAGTACTATCAGGCATGGCTTGAGATGACGATCCAAGTGAGGGAGGAGATGGAGCCATCTCAGGTGAGAGCC
AATCGTGAGGCCCAACACAAATACCTGACATGGCGAGCACAGAAGGATCCTGGACATGGTCTTCTTAAAAGATTAGTTGG
TGAAGTAAAAGCAAAGGAGCTGCTAAGGGATTTCCTATTCAGTGGGGTAGATGAGTTAGGCACAAAAACATTCATTGATT
ACTTTCCAGAGTACCAAACAGAAGATGGAACTGTGAGCGACAAACGAAGCATCATTGGGAAGTCATATGAAACTCGGCCT
TGGGATCTAACAGGACAATTTATCGGCTAA