Details for Capsella Locus Carubv10014159m

Position : scaf_3 ( 5`- 13516589 .. 13518245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014159m

Protein [Map View]
MSRCYPFPPPGYVRKEISRDKCLIESIKGAKGEVKKDRKHKRKGTKRKESENEAGQSRKHSHKRRRKEEGVNASGKLINS
EVELLEKSCQTVEPELQTSSQNSCDSTLRSNERPKKIQSQPLYETGIQTRLPEKGQKDPEDEVMMTNKVQKQRFSRERLD
ATQAAAPNESVSHDALRVCQENRRDPNFGSSRDITIKLSKEKKSVPSKDKRKVSKKDTMRSSSSWTHPELEKPSSSHQET
NGPSKLSCRKCPPSMAGQLLNLIENWAPDRVESKLTECEDQEWWLFIKFGAKRQQVSNQKTNEGSCSVVWPTARFLPEAE
LHALPFTVPF*

DNA
ATGTCTCGGTGCTATCCGTTTCCACCACCTGGTTATGTACGGAAAGAAATCAGCAGGGATAAGTGTCTGATCGAATCGAT
CAAGGGGGCAAAGGGGGAAGTTAAGAAAGATAGAAAACACAAGAGGAAGGGTACAAAGAGAAAGGAGAGTGAAAATGAGG
CGGGTCAAAGCAGAAAGCACAGCCATAAGAGAAGGCGCAAAGAAGAAGGTGTGAATGCTAGTGGCAAGTTAATTAATAGT
GAGGTCGAGTTGTTAGAGAAGAGCTGCCAGACAGTGGAACCTGAGCTTCAAACATCGTCTCAGAATTCTTGTGATAGCAC
TCTTCGTAGCAATGAGAGACCAAAGAAAATTCAGAGTCAGCCCCTTTATGAAACCGGCATACAGACCCGGTTACCTGAAA
AAGGGCAGAAAGATCCTGAGGATGAGGTGATGATGACCAACAAGGTTCAAAAACAGCGCTTTTCCCGGGAAAGGTTAGAT
GCTACTCAGGCCGCTGCTCCAAATGAGTCTGTTAGTCATGATGCTTTAAGGGTCTGTCAAGAGAATAGAAGAGATCCAAA
TTTTGGTTCGTCAAGAGACATCACAATAAAACTCAGCAAAGAGAAGAAATCAGTTCCTTCGAAAGATAAGAGAAAAGTTA
GTAAAAAAGATACGATGCGATCATCATCTTCATGGACTCATCCAGAACTAGAGAAACCGTCCTCTAGTCATCAGGAAACC
AATGGACCTTCTAAGCTATCATGCAGGAAATGCCCTCCTTCCATGGCCGGACAGTTGTTGAATCTCATCGAGAACTGGGC
TCCTGATCGGGTTGAGAGCAAGCTGACTGAGTGTGAAGATCAAGAATGGTGGTTGTTCATCAAGTTTGGAGCCAAAAGGC
AACAAGTTAGCAATCAGAAAACCAACGAGGGAAGTTGTTCGGTGGTGTGGCCAACTGCTCGATTCCTTCCTGAAGCCGAA
CTACACGCATTGCCATTCACTGTCCCGTTTTGA