Details for Capsella Locus Carubv10014156m

Position : scaf_3 ( 5`- 5658555 .. 5660837 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014156m

Protein [Map View]
MNTTAHRTPKSGRQSLLFQDLASPVSARRGKFSSPGQAAAVSALWRENFGGSDLPPPPMNTLDDLSDFSPESGIADYSAS
PDVKSDRRTPFQSSGKNIVTPGKGKLEASPSFSLLNAQQSQQVSGSPSWWSQPKAGSSMEQDDKGKGSPVEGVVQPGALV
TLPPPREVARPEVQRQIIPTGNLDEEEWVTVYGFSPGDTNLVLREFEKCGMILKHVPGPRNANWMNILYQNRSDAHKALN
KSGMMINGVVIVGVKPVDPIQKQALNERLNNQGFMPLPPPSSTRDTARPSSRPQFLQNGSAAFPAQPSSGAMASPSKSMV
SKFLDLMFSV*

DNA
ATGAATACTACAGCTCACAGGACTCCTAAATCAGGGAGGCAATCTCTGCTTTTTCAAGATTTAGCTTCTCCTGTTTCAGC
ACGCAGAGGGAAATTCTCGAGCCCGGGCCAAGCAGCTGCGGTTTCTGCACTATGGCGTGAGAATTTTGGAGGGTCGGATC
TTCCACCTCCTCCGATGAACACTTTGGATGACTTGTCAGACTTTTCTCCTGAGTCAGGTATTGCGGACTACTCAGCGTCT
CCAGATGTCAAATCTGACAGAAGAACGCCTTTCCAGAGTTCTGGGAAAAATATTGTAACTCCTGGTAAAGGAAAGTTGGA
AGCAAGCCCCTCTTTTTCTCTACTGAATGCACAACAGAGTCAGCAAGTTTCAGGGAGTCCGAGTTGGTGGTCGCAGCCAA
AGGCAGGTAGTAGTATGGAGCAGGATGATAAAGGTAAGGGATCTCCAGTAGAAGGTGTGGTTCAGCCAGGTGCATTGGTC
ACTCTTCCACCGCCAAGAGAAGTTGCTAGGCCAGAGGTTCAGAGGCAGATCATACCCACTGGAAACCTTGATGAGGAAGA
GTGGGTCACTGTCTATGGATTTTCTCCAGGTGATACAAATTTGGTACTACGGGAGTTTGAAAAGTGTGGTATGATCTTGA
AACATGTTCCTGGTCCAAGGAATGCTAACTGGATGAACATCCTCTACCAGAACCGGTCTGATGCACATAAAGCGCTGAAC
AAATCTGGGATGATGATTAATGGAGTGGTTATAGTAGGAGTGAAGCCAGTAGACCCGATACAGAAGCAAGCGTTAAACGA
GAGACTTAACAACCAAGGATTCATGCCTTTACCTCCACCATCATCCACTAGGGACACTGCTCGACCCTCATCACGTCCTC
AGTTCTTGCAAAATGGTAGCGCTGCTTTCCCCGCTCAACCCAGCAGTGGTGCTATGGCCTCCCCATCTAAGTCGATGGTC
TCAAAGTTCTTAGACTTGATGTTCAGTGTTTAA